Free for academic non-profit institutions. Other users need a Commercial license

Aliases for CAMK1D Gene

Aliases for CAMK1D Gene

  • Calcium/Calmodulin Dependent Protein Kinase ID 2 3 5
  • CaM Kinase I Delta 3 4
  • CaM Kinase ID 3 4
  • CaM-KI Delta 3 4
  • EC 2.7.11.17 4 61
  • CaMKI Delta 3 4
  • CaMKID 3 4
  • CKLiK 3 4
  • Calcium/Calmodulin-Dependent Protein Kinase Type 1D 3
  • Calcium/Calmodulin-Dependent Protein Kinase ID 2
  • CamKI-Like Protein Kinase 3
  • CaMKI-Like Protein Kinase 4
  • EC 2.7.11 61
  • CaM-K1 3

External Ids for CAMK1D Gene

Previous GeneCards Identifiers for CAMK1D Gene

  • GC10P012395
  • GC10P012431

Summaries for CAMK1D Gene

Entrez Gene Summary for CAMK1D Gene

  • This gene is a member of the calcium/calmodulin-dependent protein kinase 1 family, a subfamily of the serine/threonine kinases. The encoded protein is a component of the calcium-regulated calmodulin-dependent protein kinase cascade. It has been associated with multiple processes including regulation of granulocyte function, activation of CREB-dependent gene transcription, aldosterone synthesis, differentiation and activation of neutrophil cells, and apoptosis of erythroleukemia cells. Alternatively spliced transcript variants encoding different isoforms of this gene have been described. [provided by RefSeq, Jan 2015]

GeneCards Summary for CAMK1D Gene

CAMK1D (Calcium/Calmodulin Dependent Protein Kinase ID) is a Protein Coding gene. Among its related pathways are MAPK-Erk Pathway and Insulin secretion. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is CAMK1.

UniProtKB/Swiss-Prot for CAMK1D Gene

  • Calcium/calmodulin-dependent protein kinase that operates in the calcium-triggered CaMKK-CaMK1 signaling cascade and, upon calcium influx, activates CREB-dependent gene transcription, regulates calcium-mediated granulocyte function and respiratory burst and promotes basal dendritic growth of hippocampal neurons. In neutrophil cells, required for cytokine-induced proliferative responses and activation of the respiratory burst. Activates the transcription factor CREB1 in hippocampal neuron nuclei. May play a role in apoptosis of erythroleukemia cells. In vitro, phosphorylates transcription factor CREM isoform Beta.

No data available for Tocris Summary , Gene Wiki entry , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for CAMK1D Gene

Genomics for CAMK1D Gene

Regulatory Elements for CAMK1D Gene

Enhancers for CAMK1D Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH10F012262 1.2 FANTOM5 Ensembl ENCODE 44.9 -84.8 -84812 4.1 HDGF PKNOX1 SIN3A YBX1 FEZF1 ZNF2 YY1 CBX5 ZNF143 ZNF207 CAMK1D MIR548Q UPF2 SEC61A2 GC10P012264 GC10M012285
GH10F012240 1.4 FANTOM5 Ensembl ENCODE 32.1 -106.2 -106211 5.2 CTCF PKNOX1 ZNF146 MAX BMI1 EBF1 ZBTB40 RELA EGR1 EED CAMK1D MIR548Q NUDT5 UPF2 SEC61A2 ENSG00000228302
GH10F012219 1.1 FANTOM5 ENCODE 22.9 -128.4 -128355 3.3 HDGF CREB3L1 ZFP64 SIN3A YBX1 ZNF2 YY1 CBX5 ZNF143 ZNF207 CAMK1D NUDT5 ENSG00000228302
GH10F012268 1.4 FANTOM5 Ensembl ENCODE 21.8 -79.0 -78982 3.4 CTCF KLF1 JUN INSM2 FEZF1 ZNF101 ZNF366 ELK1 PATZ1 PRDM10 CAMK1D UPF2 GC10P012264 GC10M012285
GH10F012418 0.9 Ensembl ENCODE 21.8 +69.8 69770 2.3 ZNF639 BHLHE40 INSM2 MAFG ZNF264 JUND ZNF692 ZNF366 EED FOS CAMK1D BTBD7P1 ENSG00000252438 GC10M012437
- Elite enhancer/Elite enhancer-gene association Download Table
Download GeneHancer data dump

Enhancers around CAMK1D on UCSC Golden Path with GeneCards custom track

Promoters for CAMK1D Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00000350806 518 2801 KLF17 BMI1 FEZF1 RAD21 ZNF2 YY1 EGR1 ZNF366 ETV6 EGR2

Genomic Location for CAMK1D Gene

Chromosome:
10
Start:
12,349,482 bp from pter
End:
12,835,545 bp from pter
Size:
486,064 bases
Orientation:
Plus strand

Genomic View for CAMK1D Gene

Genes around CAMK1D on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
CAMK1D Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for CAMK1D Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for CAMK1D Gene

Proteins for CAMK1D Gene

  • Protein details for CAMK1D Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q8IU85-KCC1D_HUMAN
    Recommended name:
    Calcium/calmodulin-dependent protein kinase type 1D
    Protein Accession:
    Q8IU85
    Secondary Accessions:
    • B0YIY0
    • Q9HD31

    Protein attributes for CAMK1D Gene

    Size:
    385 amino acids
    Molecular mass:
    42914 Da
    Quaternary structure:
    No Data Available

    Three dimensional structures from OCA and Proteopedia for CAMK1D Gene

    Alternative splice isoforms for CAMK1D Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for CAMK1D Gene

Selected DME Specific Peptides for CAMK1D Gene

Q8IU85:
  • KCIPKKAL
  • QAFNATAVVRHMR
  • KLFEQILKAEYEFDSPYWDDISDSAKDFIR
  • STACGTPGYVAPEVLAQKPYSKAVDCWSIGVI
  • KNFAKSKW
  • GGELFDR
  • SKIMISDFGLSKME
  • ENEIAVL
  • ISDSAKD
  • YVAPEVL
  • LKPENLL
  • RDLKPEN
  • VHRDLKP
  • MQLVSGGELFDRI
  • IVHRDLK

Post-translational modifications for CAMK1D Gene

  • Modification sites at PhosphoSitePlus
  • Modification sites at neXtProt

Antibody Products

  • Cell Signaling Technology (CST) Antibodies for CAMK1D (CAMK1D)
  • Abcam antibodies for CAMK1D

Domains & Families for CAMK1D Gene

Gene Families for CAMK1D Gene

Graphical View of Domain Structure for InterPro Entry

Q8IU85

UniProtKB/Swiss-Prot:

KCC1D_HUMAN :
  • The autoinhibitory domain overlaps with the calmodulin binding region and interacts in the inactive folded state with the catalytic domain as a pseudosubstrate.
  • Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. CaMK subfamily.
Domain:
  • The autoinhibitory domain overlaps with the calmodulin binding region and interacts in the inactive folded state with the catalytic domain as a pseudosubstrate.
  • Contains 1 protein kinase domain.
Family:
  • Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. CaMK subfamily.
genes like me logo Genes that share domains with CAMK1D: view

Function for CAMK1D Gene

Molecular function for CAMK1D Gene

UniProtKB/Swiss-Prot CatalyticActivity:
ATP + a protein = ADP + a phosphoprotein.
UniProtKB/Swiss-Prot EnzymeRegulation:
Activated by Ca(2+)/calmodulin. Binding of calmodulin results in conformational change that relieves intrasteric autoinhibition and allows phosphorylation of Thr-180 within the activation loop by CaMKK1 or CaMKK2. Phosphorylation of Thr-180 results in several fold increase in total activity. Unlike CaMK4, may be unable to exhibit autonomous activity after Ca(2+)/calmodulin activation.
UniProtKB/Swiss-Prot Function:
Calcium/calmodulin-dependent protein kinase that operates in the calcium-triggered CaMKK-CaMK1 signaling cascade and, upon calcium influx, activates CREB-dependent gene transcription, regulates calcium-mediated granulocyte function and respiratory burst and promotes basal dendritic growth of hippocampal neurons. In neutrophil cells, required for cytokine-induced proliferative responses and activation of the respiratory burst. Activates the transcription factor CREB1 in hippocampal neuron nuclei. May play a role in apoptosis of erythroleukemia cells. In vitro, phosphorylates transcription factor CREM isoform Beta.
UniProtKB/Swiss-Prot Induction:
Expression increases upon treatment of EC cells with DMSO and retinoic acid. Induced by KCL in PC12 cells.

Enzyme Numbers (IUBMB) for CAMK1D Gene

Gene Ontology (GO) - Molecular Function for CAMK1D Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0003824 catalytic activity IEA --
GO:0004672 protein kinase activity IEA --
GO:0004674 protein serine/threonine kinase activity IEA --
GO:0004683 calmodulin-dependent protein kinase activity IEA,IBA --
GO:0005516 calmodulin binding IEA,IBA --
genes like me logo Genes that share ontologies with CAMK1D: view
genes like me logo Genes that share phenotypes with CAMK1D: view

Animal Model Products

  • Taconic Biosciences Mouse Models for CAMK1D

Inhibitory RNA Products

Flow Cytometry Products

No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for CAMK1D Gene

Localization for CAMK1D Gene

Subcellular locations from UniProtKB/Swiss-Prot for CAMK1D Gene

Cytoplasm. Nucleus. Note=Predominantly cytoplasmic. Nuclear localization increases upon activation by KCl treatment in hippocampal neurons.

Subcellular locations from

COMPARTMENTS
Jensen Localization Image for CAMK1D Gene COMPARTMENTS Subcellular localization image for CAMK1D gene
Compartment Confidence
nucleus 5
cytosol 4
extracellular 1
mitochondrion 1
peroxisome 1
plasma membrane 1

Gene Ontology (GO) - Cellular Components for CAMK1D Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005634 nucleus IEA,IDA 16324104
GO:0005737 cytoplasm IEA,IDA 16324104
genes like me logo Genes that share ontologies with CAMK1D: view

Pathways & Interactions for CAMK1D Gene

genes like me logo Genes that share pathways with CAMK1D: view

Pathways by source for CAMK1D Gene

1 Cell Signaling Technology pathway for CAMK1D Gene
1 PharmGKB pathway for CAMK1D Gene

Interacting Proteins for CAMK1D Gene

Selected Interacting proteins: Q8IU85-KCC1D_HUMAN for CAMK1D Gene via IID

Gene Ontology (GO) - Biological Process for CAMK1D Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006468 protein phosphorylation IEA --
GO:0006954 inflammatory response IEA --
GO:0007399 nervous system development IEA --
GO:0008152 metabolic process IEA --
GO:0010976 positive regulation of neuron projection development ISS --
genes like me logo Genes that share ontologies with CAMK1D: view

No data available for SIGNOR curated interactions for CAMK1D Gene

Drugs & Compounds for CAMK1D Gene

(5) Drugs for CAMK1D Gene - From: DrugBank, PharmGKB, HMDB, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Losartan Approved Pharma Antagonist 282
Adenosine triphosphate Approved Nutra 0
N-(5-METHYL-1H-PYRAZOL-3-YL)-2-PHENYLQUINAZOLIN-4-AMINE Experimental Pharma Target 0
calcium Nutra 0

(1) Additional Compounds for CAMK1D Gene - From: HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
ADP
  • Adenosindiphosphorsaeure
  • Adenosine 5'-pyrophosphate
  • Adenosine diphosphate
  • Adenosine pyrophosphate
  • Adenosine-5'-diphosphate
Full agonist, Agonist 58-64-0
genes like me logo Genes that share compounds with CAMK1D: view

Transcripts for CAMK1D Gene

Unigene Clusters for CAMK1D Gene

Calcium/calmodulin-dependent protein kinase ID:
Representative Sequences:

Inhibitory RNA Products

Flow Cytometry Products

Alternative Splicing Database (ASD) splice patterns (SP) for CAMK1D Gene

No ASD Table

Relevant External Links for CAMK1D Gene

GeneLoc Exon Structure for
CAMK1D
ECgene alternative splicing isoforms for
CAMK1D

Expression for CAMK1D Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for CAMK1D Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

mRNA differential expression in normal tissues according to GTEx for CAMK1D Gene

This gene is overexpressed in Brain - Frontal Cortex (BA9) (x4.8).

Protein differential expression in normal tissues from HIPED for CAMK1D Gene

This gene is overexpressed in Brain (10.5), Peripheral blood mononuclear cells (10.1), Lung (8.3), and Pancreas (7.4).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for CAMK1D Gene



Protein tissue co-expression partners for CAMK1D Gene

NURSA nuclear receptor signaling pathways regulating expression of CAMK1D Gene:

CAMK1D

SOURCE GeneReport for Unigene cluster for CAMK1D Gene:

Hs.659517

mRNA Expression by UniProt/SwissProt for CAMK1D Gene:

Q8IU85-KCC1D_HUMAN
Tissue specificity: Widely expressed. Highly and mostly expressed in polymorphonuclear leukocytes (neutrophilic and eosinophilic granulocytes) while little or no expression is observed in monocytes and lymphocytes.
genes like me logo Genes that share expression patterns with CAMK1D: view

Primer Products

Orthologs for CAMK1D Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for CAMK1D Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia CAMK1D 34 35
  • 99.31 (n)
oppossum
(Monodelphis domestica)
Mammalia CAMK1D 35
  • 97 (a)
OneToOne
platypus
(Ornithorhynchus anatinus)
Mammalia CAMK1D 35
  • 92 (a)
OneToOne
cow
(Bos Taurus)
Mammalia CAMK1D 34 35
  • 91.55 (n)
dog
(Canis familiaris)
Mammalia CAMK1D 34 35
  • 91.43 (n)
mouse
(Mus musculus)
Mammalia Camk1d 34 16 35
  • 90.56 (n)
rat
(Rattus norvegicus)
Mammalia Camk1d 34
  • 90.3 (n)
chicken
(Gallus gallus)
Aves CAMK1D 34 35
  • 82.68 (n)
lizard
(Anolis carolinensis)
Reptilia CAMK1D 35
  • 91 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia camk1d 34
  • 76.19 (n)
zebrafish
(Danio rerio)
Actinopterygii camk1da 34 35
  • 77.85 (n)
camk1db 35
  • 77 (a)
OneToMany
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes CMK1 34
  • 49.94 (n)
thale cress
(Arabidopsis thaliana)
eudicotyledons CPK20 34
  • 47.01 (n)
rice
(Oryza sativa)
Liliopsida Os03g0788500 34
  • 51.17 (n)
sea squirt
(Ciona savignyi)
Ascidiacea -- 35
  • 63 (a)
OneToMany
Species where no ortholog for CAMK1D was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • fruit fly (Drosophila melanogaster)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)
  • worm (Caenorhabditis elegans)

Evolution for CAMK1D Gene

ENSEMBL:
Gene Tree for CAMK1D (if available)
TreeFam:
Gene Tree for CAMK1D (if available)

Paralogs for CAMK1D Gene

Paralogs for CAMK1D Gene

genes like me logo Genes that share paralogs with CAMK1D: view

Variants for CAMK1D Gene

Sequence variations from dbSNP and Humsavar for CAMK1D Gene

SNP ID Clin Chr 10 pos Sequence Context AA Info Type
rs1004247 -- 12,644,488(-) GAGGT(C/T)TCTAG intron-variant
rs1004248 -- 12,644,285(-) GTTTT(C/T)GTTGG intron-variant
rs10047304 -- 12,830,572(+) CAAAG(A/C)AGGCT utr-variant-3-prime
rs10047332 -- 12,832,551(+) TCTGT(C/T)GGAGA utr-variant-3-prime
rs10047334 -- 12,832,748(+) AGTCT(A/C)ACTCT utr-variant-3-prime

Structural Variations from Database of Genomic Variants (DGV) for CAMK1D Gene

Variant ID Type Subtype PubMed ID
dgv366n106 CNV tandem duplication 24896259
dgv370e59 CNV duplication 20981092
dgv675n100 CNV loss 25217958
dgv676n100 CNV gain 25217958
dgv93e201 CNV deletion 23290073
dgv97e214 CNV loss 21293372
esv1011108 CNV deletion 20482838
esv1080827 CNV deletion 17803354
esv1543093 CNV deletion 17803354
esv1681196 CNV deletion 17803354
esv1750238 CNV deletion 17803354
esv2045613 CNV deletion 18987734
esv22086 CNV loss 19812545
esv2316922 CNV deletion 18987734
esv24335 CNV gain 19812545
esv2494590 CNV deletion 19546169
esv2505519 CNV deletion 19546169
esv2601612 CNV insertion 19546169
esv2657367 CNV deletion 23128226
esv2658042 CNV deletion 23128226
esv2662299 CNV deletion 23128226
esv2666513 CNV deletion 23128226
esv2673405 CNV deletion 23128226
esv2673513 CNV deletion 23128226
esv2675595 CNV deletion 23128226
esv2676569 CNV deletion 23128226
esv2733162 CNV deletion 23290073
esv2733173 CNV deletion 23290073
esv2733184 CNV deletion 23290073
esv2733195 CNV deletion 23290073
esv2733206 CNV deletion 23290073
esv2733217 CNV deletion 23290073
esv2733239 CNV deletion 23290073
esv2733262 CNV deletion 23290073
esv2733273 CNV deletion 23290073
esv2733284 CNV deletion 23290073
esv29514 CNV loss 19812545
esv3029 CNV loss 18987735
esv3264273 CNV deletion 24192839
esv3264384 CNV deletion 24192839
esv3331 CNV loss 18987735
esv3404931 CNV duplication 20981092
esv3413470 CNV duplication 20981092
esv3426998 CNV insertion 20981092
esv3545914 CNV deletion 23714750
esv3545915 CNV deletion 23714750
esv3578640 CNV loss 25503493
esv3578641 CNV loss 25503493
esv3622363 CNV gain 21293372
esv3622373 CNV loss 21293372
esv3622374 CNV loss 21293372
esv3622377 CNV gain 21293372
esv3622378 CNV loss 21293372
esv3622380 CNV loss 21293372
esv3622381 CNV loss 21293372
esv3622382 CNV loss 21293372
esv3622384 CNV loss 21293372
esv3622385 CNV loss 21293372
esv3622386 CNV loss 21293372
esv3891758 CNV loss 25118596
esv7711 CNV loss 19470904
nsv1041648 CNV gain 25217958
nsv1068672 CNV deletion 25765185
nsv1068673 CNV deletion 25765185
nsv1069022 CNV deletion 25765185
nsv1069023 CNV deletion 25765185
nsv1069453 CNV deletion 25765185
nsv1069454 CNV deletion 25765185
nsv1073741 CNV deletion 25765185
nsv1078880 OTHER inversion 25765185
nsv1112574 CNV deletion 24896259
nsv1112575 CNV deletion 24896259
nsv1126243 CNV deletion 24896259
nsv1127087 CNV deletion 24896259
nsv1132329 CNV duplication 24896259
nsv1135768 CNV deletion 24896259
nsv1137420 CNV deletion 24896259
nsv1137875 CNV deletion 24896259
nsv1137876 CNV deletion 24896259
nsv1141908 OTHER inversion 24896259
nsv1143492 CNV deletion 24896259
nsv1145431 CNV deletion 24896259
nsv1148224 OTHER inversion 26484159
nsv24363 CNV deletion 16902084
nsv466740 CNV gain 19166990
nsv466741 CNV loss 19166990
nsv466742 CNV loss 19166990
nsv470920 CNV gain 18288195
nsv470921 CNV loss 18288195
nsv472626 CNV novel sequence insertion 20440878
nsv498720 CNV loss 21111241
nsv507540 OTHER sequence alteration 20534489
nsv510212 OTHER sequence alteration 20534489
nsv512147 CNV loss 21212237
nsv513006 CNV insertion 21212237
nsv517854 CNV loss 19592680
nsv520469 CNV loss 19592680
nsv522620 CNV loss 19592680
nsv524505 CNV loss 19592680
nsv549971 CNV loss 21841781
nsv549972 CNV gain 21841781
nsv549973 CNV loss 21841781
nsv549974 CNV loss 21841781
nsv549975 CNV loss 21841781
nsv549976 CNV loss 21841781
nsv820494 CNV deletion 20802225
nsv825249 CNV loss 20364138
nsv831786 CNV loss 17160897
nsv951250 CNV deletion 24416366
nsv955918 CNV deletion 24416366
nsv957350 CNV deletion 24416366

Variation tolerance for CAMK1D Gene

Residual Variation Intolerance Score: 19.4% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 0.59; 12.69% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for CAMK1D Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
CAMK1D

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for CAMK1D Gene

Disorders for CAMK1D Gene

Relevant External Links for CAMK1D

Genetic Association Database (GAD)
CAMK1D
Human Genome Epidemiology (HuGE) Navigator
CAMK1D
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
CAMK1D

No disorders were found for CAMK1D Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for CAMK1D Gene

Publications for CAMK1D Gene

  1. Identification and characterization of CKLiK, a novel granulocyte Ca++/calmodulin-dependent protein kinase. (PMID: 11050006) Verploegen S. … Coffer P.J. (Blood 2000) 2 3 4 22 64
  2. Characterization of the role of CaMKI-like kinase (CKLiK) in human granulocyte function. (PMID: 15840691) Verploegen S. … Coffer P.J. (Blood 2005) 3 4 22 64
  3. Identification and characterization of novel components of a Ca2+/calmodulin-dependent protein kinase cascade in HeLa cells. (PMID: 12935886) Ishikawa Y. … Kobayashi R. (FEBS Lett. 2003) 3 4 22 64
  4. Polygenic risk variants for type 2 diabetes susceptibility modify age at diagnosis in monogenic HNF1A diabetes. (PMID: 19794065) Lango Allen H. … Weedon M.N. (Diabetes 2010) 3 46 64
  5. Gene variants in the novel type 2 diabetes loci CDC123/CAMK1D, THADA, ADAMTS9, BCL11A, and MTNR1B affect different aspects of pancreatic beta-cell function. (PMID: 19833888) Simonis-Bik A.M. … 't Hart L.M. (Diabetes 2010) 3 46 64

Products for CAMK1D Gene

Sources for CAMK1D Gene

Content
Loading form....