Set Analyses:
Advanced Search

Advanced Search

 
Search By
Section (entire)
for


 
or upload a file of gene symbols


Category   Symbol Source: HGNC EntrezGene Ensembl GeneCards RNA genes CroW21
GIFtS

BRCA1 Gene

protein-coding   GIFtS: 71
GCID: GC17M041197

breast cancer 1, early onset

 Explore 125 diseases affiliated with
BRCA1 via our new
 Human Malady Compendium 
Biological research products
for BRCA1
    

(According to 1HGNC, 2Entrez Gene,
3UniProtKB/Swiss-Prot, 4UniProtKB/TrEMBL, 5OMIM, 6GeneLoc, 7Ensembl, 8DME, 9miRBase, and/or 10fRNAdb)
About This Section

This gene clusters with an RNA gene
Subcategory (RNA class): lncRNA

Quality score for the ORGUL clustered with this gene is 3

Aliases
Breast Cancer 1, Early Onset1 2     IRIS2
RNF531 2 3     BRCA1/BRCA2-Containing Complex, Subunit 12
BRCC11 2     Breast And Ovarian Cancer Susceptibility Protein 12
PPP1R531 2     Breast And Ovarian Cancer Sususceptibility Protein 12
RING Finger Protein 532 3     Breast Cancer Type 1 Susceptibility Protein2
BROVCA12 5     Protein Phosphatase 1, Regulatory Subunit 532
PNCA42 5     EC 6.3.2.-3
PSCP2 5     EC 6.3.28
BRCAI2     

External Ids:    HGNC: 11001   Entrez Gene: 6722   Ensembl: ENSG000000120487   OMIM: 1137055   UniProtKB: P383983   
ORGUL members:         
NONCODE:n407962    

Export aliases for BRCA1 gene to outside databases

Previous GC identifers: GC17P062255 GC17M043361 GC17M041105 GC17M041569 GC17M038450 GC17M036962


(According to Entrez Gene, Tocris Bioscience, Wikipedia's Gene Wiki, PharmGKB,
UniProtKB/Swiss-Prot, and/or UniProtKB/TrEMBL)
About This Section

Entrez Gene summary for BRCA1:
This gene encodes a nuclear phosphoprotein that plays a role in maintaining genomic stability, and it also acts as a
tumor suppressor. The encoded protein combines with other tumor suppressors, DNA damage sensors, and signal
transducers to form a large multi-subunit protein complex known as the BRCA1-associated genome surveillance complex
(BASC). This gene product associates with RNA polymerase II, and through the C-terminal domain, also interacts with
histone deacetylase complexes. This protein thus plays a role in transcription, DNA repair of double-stranded breaks,
and recombination. Mutations in this gene are responsible for approximately 40% of inherited breast cancers and more
than 80% of inherited breast and ovarian cancers. Alternative splicing plays a role in modulating the subcellular
localization and physiological function of this gene. Many alternatively spliced transcript variants, some of which
are disease-associated mutations, have been described for this gene, but the full-length natures of only some of these
variants has been described. A related pseudogene, which is also located on chromosome 17, has been identified.
(provided by RefSeq, May 2009)

UniProtKB/Swiss-Prot: BRCA1_HUMAN, P38398
Function: E3 ubiquitin-protein ligase that specifically mediates the formation of 'Lys-6'-linked polyubiquitin chains
and plays a central role in DNA repair by facilitating cellular responses to DNA damage. It is unclear whether it also
mediates the formation of other types of polyubiquitin chains. The E3 ubiquitin-protein ligase activity is required
for its tumor suppressor function. The BRCA1-BARD1 heterodimer coordinates a diverse range of cellular pathways such
as DNA damage repair, ubiquitination and transcriptional regulation to maintain genomic stability. Regulates
centrosomal microtubule nucleation. Required for normal cell cycle progression from G2 to mitosis. Required for
appropriate cell cycle arrests after ionizing irradiation in both the S-phase and the G2 phase of the cell cycle.
Involved in transcriptional regulation of P21 in response to DNA damage. Required for FANCD2 targeting to sites of DNA
damage. May function as a transcriptional regulator. Inhibits lipid synthesis by binding to inactive phosphorylated
ACACA and preventing its dephosphorylation. Contributes to homologous recombination repair (HRR) via its direct
interaction with PALB2, fine-tunes recombinational repair partly through its modulatory role in the PALB2-dependent
loading of BRCA2-RAD51 repair machinery at DNA breaks. Component of the BRCA1-RBBP8 complex which regulates CHEK1
activation and controls cell cycle G2/M checkpoints on DNA damage via BRCA1-mediated ubiquitination of RBBP8

Gene Wiki entry for BRCA1 (Talk:BRCA1)

PharmGKB "VIP" summary for BRCA1


(According to GeneLoc and/or HGNC, and/or
Entrez Gene (NCBI build 37),
and/or miRBase,
Genomic Views according to UCSC (hg19) and Ensembl (release 69), Regulatory elements and Epigenetics data according to QIAGEN, SABiosciences, and/or SwitchGear Genomics)
About This Section
RefSeq DNA sequence:
NC_000017.10  NC_018928.1  NT_010783.15  
Regulatory elements:
   SABiosciences Regulatory transcription factor binding sites in the BRCA1 gene promoter:
         ATF-2   
         Other transcription factors

SwitchGear Promoter luciferase reporter plasmidBRCA1 promoter sequence
   Search SABiosciences Chromatin IP Primers for BRCA1

Epigenetics:
QIAGEN PyroMark CpG Assay predesigned Pyrosequencing DNA Methylation assays in human, mouse, rat BRCA1


Genomic Location:
Genomic View: UCSC Golden Path with GeneCards custom track

Entrez Gene cytogenetic band: 17q21   Ensembl cytogenetic band:  17q21.31   HGNC cytogenetic band: 17q21.31

BRCA1 Gene in genomic location: bands according to Ensembl, locations according to (and/or Entrez Gene and/or Ensembl if different)
BRCA1 gene location

GeneLoc information about chromosome 17         GeneLoc Exon Structure

GeneLoc location for GC17M041197:  view genomic region     (about GC identifiers)

Start:
41,196,312 bp from pter      End:
41,322,290 bp from pter
Size:
125,979 bases      Orientation:
minus strand

(According to 1UniProtKB, HORDE, neXtProt, Ensembl, and/or Reactome, Modification sites according to 2PhosphoSitePlus, Specific Peptides from DME, Protein expression images according to data from SPIRE MOPED and PaxDb, RefSeq according to NCBI, PDB rendering according to OCA and/or Proteopedia, Recombinant Proteins from EMD Millipore, R&D Systems, GenScript, Enzo Life Sciences, OriGene, Novus Biologicals, Sino Biological, ProSpec, and/or Uscn,
Biochemical Assays by EMD Millipore, R&D Systems, OriGene, GenScript, Cell Signaling Technology, Enzo Life Sciences, and/or Uscn, Ontologies according to Gene Ontology Consortium 01 Mar 2013 and Entrez Gene, Antibodies by EMD Millipore, R&D Systems, GenScript, Cell Signaling Technology, OriGene, Novus Biologicals, Thermo Fisher Scientific, Abcam, and/or Uscn)
About This Section

UniProtKB/Swiss-Prot: BRCA1_HUMAN, P38398 (See protein sequence)
Recommended Name: Breast cancer type 1 susceptibility protein  
Size: 1863 amino acids; 207721 Da
Subunit: Heterodimer with BARD1. Part of the BRCA1-associated genome surveillance complex (BASC), which contains BRCA1,
MSH2, MSH6, MLH1, ATM, BLM, PMS2 and the MRE11-RAD50-NBN protein (MRN) complex. This association could be a dynamic
process changing throughout the cell cycle and within subnuclear domains. Component of the BRCA1-A complex, at least
composed of the BRCA1, BARD1, UIMC1, BRCC3, BRE and BABAM1. Interacts (via the BRCT domains) with FAM175A. Component
of the BRCA1-RBBP8 complex. Interacts (via the BRCT domains) with RBBP8 ('Ser-327' phosphorylated form); the
interaction ubiquitinates RBBP8, regulates CHEK1 activation, and involves RBBP8 in BRCA1-dependent G2/M checkpoint
control on DNA damage. Associates with RNA polymerase II holoenzyme. Interacts with SMC1A and COBRA1. Interacts (via
BRCT domains) with BRIP1 (phosphorylated form). Interacts with FANCD2 (ubiquitinated form). Interacts with BAP1.
Interacts with DCLRE1C and CLSPN. Interacts with H2AFX (phosphorylated on 'Ser-140'). Interacts with CHEK1 and CHEK2.
Interacts with BRCC3. Interacts (via the BRCT domains) with ACACA (phosphorylated form); the interaction prevents
dephosphorylation of ACACA. Interacts with AURKA. Interacts with UBXN1. Part of a trimeric complex containing BRCA1,
BRCA2 and PALB2. Interacts directly with PALB2; the interaction is essential for its function in HRR. Interacts
directly with BRCA2; the interaction occurs only in the presence of PALB2 which serves as the bridging protein.
Interacts (via the BRCT domains) with LMO4; the interaction represses the transcriptional activity of BRCA1. Interacts
with KIAA0101/PAF15
Subcellular location: Nucleus. Chromosome (By similarity). Note=Localizes at sites of DNA damage at double-strand
breaks (DSBs); recruitment to DNA damage sites is mediated by the BRCA1-A complex
Subcellular location: Isoform 3: Cytoplasm
Subcellular location: Isoform 5: Cytoplasm
6/20 PDB 3D structures from and Proteopedia for BRCA1 (see all 20):
1JM7 (3D)        1JNX (3D)        1N5O (3D)        1OQA (3D)        1T15 (3D)        1T29 (3D)    
Secondary accessions: O15129 Q3LRJ0 Q3LRJ6 Q6IN79 Q7KYU9
Alternative splicing, Alternative initiation: 6 isoforms:  P38398-1   P38398-2   P38398-3   P38398-4   P38398-5   P38398-6   (No experimental confirmation available)

Explore the universe of human proteins at neXtProt for BRCA1: NX_P38398

Post-translational modifications:

  • Phosphorylation at Ser-308 by AURKA is required for normal cell cycle progression from G2 to mitosis. Phosphorylated in
  • response to IR, UV, and various stimuli that cause checkpoint activation, probably by ATM or ATR. Phosphorylation at
    Ser-988 by CHEK2 regulates mitotic spindle assembly1
  • Autoubiquitinated, undergoes 'Lys-6'-linked polyubiquitination. 'Lys-6'-linked polyubiquitination does not promote
  • degradation1
  • View modification sites using PhosphoSitePlus2
  • View neXtProt modification sites for NX_P38398

  • 51 DME Specific Peptides for BRCA1 (P38398) (see first 4)
     AKCSIKG  GRNHQGP  CPICLEL  ITKRSLQ 
     ELQIDSC  PISQNPE  KFARKHH  DKELVSDD 
     KSFVKTKC  TNKLKRKR  YSGSSEKI  SLFSSQCS 
     LELVVSRN  RMNVEKAE  LQTERSVES  LEENNQEEQ 
     PFTHTHLAQG  SQCAAFENPK  LICKSERVHS  DVPWITLNSS 
     SNNDLNTTEK  ESETSVSEDCS  VVVQPDAWTED  SQSDILTTQQR 
     ECEQKEENQGK  ANSYNFAKKEN  ETSIEMEESELD  TPSTEKKVDLNA 
     IPSSTSALKVPQ  NDIKESSAVFSK  RFSQLVEELLKII  LEAVLEQHGSQPS 
     SKAPKKNRLRRKS  QQLEESGPHDLTE  LTASTERVNKRMS  SLDSAKKAACEFSE 
     NVEKAEFCNKSKQP  NYPSQEELIKVVDVE  THASSLQHENSSLLLT  EVSIIQSMGYRNRAKRL 
     HENKTKGDSIQNEKNPN  VVSGLTPEEFMLVYKFAR  RAKRLLQSEPENPSLQET  EEHSMSPEREMGNENIPSTVS 
     RGPKLNAMLRLGVLQPEVYKQS  TSGLHPEDFIKKADLAVQKTPE  TDYGTQESISLLEVSTLGKAKTE  TRHSTVATECLSKNTEENLLSLKNSL 
     IGQMCEAPVVTREWVLDSVALYQCQELDTYL  EFVCERTLKYFLGIAGGKWVVSYFWVTQSIKE  KNKEPGVERSSPSKCPSLDDRWYMHSCSGSLQN 

    BRCA1 Protein expression data from MOPED and PaxDb:    About this image 
    Estimated protein expression log10 (pmol).

    REFSEQ proteins (5 alternative transcripts): 
    NP_009225.1  NP_009228.2  NP_009229.2  NP_009230.2  NP_009231.2  

    ENSEMBL proteins: 
     ENSP00000350283   ENSP00000417148   ENSP00000465818   ENSP00000467329   ENSP00000465347  
     ENSP00000418775   ENSP00000418960   ENSP00000418548   ENSP00000420705   ENSP00000419481  
     ENSP00000420412   ENSP00000418819   ENSP00000418212   ENSP00000417241   ENSP00000397145  
     ENSP00000419274   ENSP00000419988   ENSP00000420253   ENSP00000418986   ENSP00000419103  
     ENSP00000420201   ENSP00000417554   ENSP00000417988   ENSP00000420781   ENSP00000326002  
     ENSP00000312236   ENSP00000246907   ENSP00000338007   ENSP00000377294   ENSP00000310938  
    Reactome Protein details: P38398
    Human Recombinant Protein Products: 
    Browse Purified and Recombinant Proteins at EMD Millipore
    Browse R&D Systems for human recombinant proteins
    Browse recombinant and purified proteins available from Enzo Life Sciences
    Browse OriGene full length recombinant human proteins expressed in human HEK293 cells
    Browse OriGene Protein Over-expression Lysates
    OriGene Custom Protein Services for BRCA1 
    GenScript Custom Purified and Recombinant Proteins Services for BRCA1
    Novus Biologicals BRCA1 Protein
    Browse Sino Biological Recombinant Proteins
    Browse ProSpec Recombinant Proteins
    Uscn Proteins for BRCA1

    Gene Ontology (GO): 5/17 cellular component terms (GO ID links to tree view) (see all 17):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0000151ubiquitin ligase complex NAS14976165
    GO:0000793condensed chromosome ----
    GO:0000794condensed nuclear chromosome ----
    GO:0001726ruffle IDA--
    GO:0005634nucleus IDA17643121


    BRCA1 for ontologies           About GeneDecksing



    BRCA1 Antibody Products: 
    EMD Millipore Mono- and Polyclonal Antibodies for the study of BRCA1
    R&D Systems Antibodies for BRCA1
    Cell Signaling Technology (CST) Antibodies for BRCA1 
    OriGene Antibodies (see all 6): BRCA1
    OriGene Custom Antibody Services for BRCA1 
    GenScript Superior Antibodies for BRCA1
    Novus Biologicals BRCA1 Antibodies
    Search for Antibodies for BRCA1 at Abcam  
    Uscn Antibodies for BRCA1
    ThermoFisher Antibodies for BRCA1

    Assay Products for BRCA1: 
    EMD Millipore Kits and Assays for the Analysis of BRCA1
    OriGene Custom Immunoassay Development
    Browse OriGene Fluorogenic Cell Assay Kits
    Browse R&D Systems for biochemical assays
    GenScript Custom Assay Services for BRCA1
    Browse Enzo Life Sciences for kits & assays
    Uscn ELISAs and CLIAs for BRCA1


    (According to InterPro, ProtoNet, UniProtKB, and/or BLOCKS, Sets of similar genes according to GeneDecks)
    About This Section

    BRCA1 for domains           About GeneDecksing

    5/7 InterPro domains/families (see all 7):
     IPR017907 Znf_RING_CS
     IPR001841 Znf_RING
     IPR011364 BRCA1
     IPR018957 Znf_C3HC4_RING-type
     IPR013083 Znf_RING/FYVE/PHD

    Graphical View of Domain Structure for InterPro Entry P38398

    ProtoNet protein and cluster: P38398

    3 Blocks protein families:
    IPB001357 BRCT domain
    IPB001841 Zn-finger
    IPB002378 Breast cancer type I susceptibility protein signature


    UniProtKB/Swiss-Prot: BRCA1_HUMAN, P38398
    Domain: The BRCT domains recognize and bind phosphorylated pSXXF motif on proteins. The interaction with the
    phosphorylated pSXXF motif of FAM175A/Abraxas, recruits BRCA1 at DNA damage sites
    Domain: The RING-type zinc finger domain interacts with BAP1
    Similarity: Contains 2 BRCT domains
    Similarity: Contains 1 RING-type zinc finger


    (According to 1UniProtKB, Genatlas, LifeMap Discovery™, IUBMB, and/or 2DME, Human phenotypes from GenomeRNAi, Animal models from MGI Mar 06 2013,
    bound targets from SABiosciences, miRNA Gene Targets from miRTarBase shRNA from OriGene, RNAi from EMD Millipore, siRNAs from OriGene, QIAGEN, microRNA from QIAGEN, Gene Editing from DNA2.0, Clones from EMD Millipore, OriGene, SwitchGear Genomics, GenScript, Sino Biological, DNA2.0, and Vector BioLabs, Cell Lines from GenScript, LifeMap BioReagents, In Situ Hybridization Assays from Advanced Cell Diagnostics, Ontologies according to Gene Ontology Consortium 01 Mar 2013 via Entrez Gene.)
    About This Section

    Function Summary:

         UniProtKB/Swiss-Prot: BRCA1_HUMAN, P38398
    Function: E3 ubiquitin-protein ligase that specifically mediates the formation of 'Lys-6'-linked polyubiquitin chains
    and plays a central role in DNA repair by facilitating cellular responses to DNA damage. It is unclear whether it also
    mediates the formation of other types of polyubiquitin chains. The E3 ubiquitin-protein ligase activity is required
    for its tumor suppressor function. The BRCA1-BARD1 heterodimer coordinates a diverse range of cellular pathways such
    as DNA damage repair, ubiquitination and transcriptional regulation to maintain genomic stability. Regulates
    centrosomal microtubule nucleation. Required for normal cell cycle progression from G2 to mitosis. Required for
    appropriate cell cycle arrests after ionizing irradiation in both the S-phase and the G2 phase of the cell cycle.
    Involved in transcriptional regulation of P21 in response to DNA damage. Required for FANCD2 targeting to sites of DNA
    damage. May function as a transcriptional regulator. Inhibits lipid synthesis by binding to inactive phosphorylated
    ACACA and preventing its dephosphorylation. Contributes to homologous recombination repair (HRR) via its direct
    interaction with PALB2, fine-tunes recombinational repair partly through its modulatory role in the PALB2-dependent
    loading of BRCA2-RAD51 repair machinery at DNA breaks. Component of the BRCA1-RBBP8 complex which regulates CHEK1
    activation and controls cell cycle G2/M checkpoints on DNA damage via BRCA1-mediated ubiquitination of RBBP8
    Enzyme regulation: The E3 ubiquitin-protein ligase activity is inhibited by phosphorylation by AURKA. Activity is
    increased by phosphatase treatment

         Genatlas biochemistry entry for BRCA1:
    nuclear cell cycle regulated phosphoprotein of breast epithelium,located at the centrosome during M phase,associating
    with RAD51 (RECA) at S phase of mitosis,putative negative regulator of cell growth (in a RB-dependent
    fashion),phosphorylated by ATM protein kinase in response to ionizing radiation induced DNA damage,then activating DNA
    repair through homologous recombination in cooperation with BRCA2,RAD51 and RAD52,P-BRCA,also complexing with RNA
    polymerase II holoenzyme,may also regulate transcription,recruiting CREBBP and interacting with components of the
    histone deacetylase complex,mediating ubiquitin-conjugating enzyme (E2)-dependent ubiquitination through the RING
    finger domain,induction of BRCA1 triggers JNK/SAPK (MAPK8) dependent apoptosis through induction of DDIT1 (GADD45)

    Enzyme Numbers (IUBMB): EC 6.3.2.-1 EC 6.3.22

    miRNA
    Products:
        
    miRTarBase miRNAs that target BRCA1:
    hsa-mir-146a (MIRT001920), hsa-mir-24 (MIRT004836), hsa-mir-15a (MIRT003333), hsa-mir-16 (MIRT003328), hsa-mir-212 (MIRT003967)

    OriGene 3'-UTR Clone (see all 5): BRCA1
    Browse MicroRNA Expression Plasmids
    QIAGEN Custom miScript Target Protector blocks miRNA-binding site of human, mouse, rat BRCA1
    8/30 QIAGEN miScript miRNA Assays for microRNAs that regulate BRCA1 (see all 30):
    hsa-miR-4291 hsa-miR-3934 hsa-miR-520d-5p hsa-miR-125a-3p hsa-miR-522 hsa-miR-944 hsa-miR-450b-3p hsa-miR-132
    SwitchGear 3'UTR luciferase reporter plasmidBRCA1 3' UTR sequence
    Inhib. RNA
    Products:
        
    EMD Millipore RNAi Products for the Analysis of BRCA1 Gene knock-down
    OriGene 29mer shRNA kits in GFP-retroviral vector in human, mouse, rat for BRCA1 (see all 7)
    OriGene shRNA RFP: BRCA1
    OriGene siRNA: BRCA1
    QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat BRCA1

    Gene Editing
    Products:
    DNA2.0 Custom Protein Engineering Service for BRCA1

    Clone
    Products:
         
    Browse Clones for the Expression of Recombinant Proteins Available from EMD Millipore
    OriGene Myc/DDK tagged cDNA clones in CMV expression vector in human, mouse, rat for BRCA1 (see all 10)
    OriGene untagged cDNA clones in CMV expression vector in human, mouse, rat for BRCA1 (see all 8)
    OriGene custom cloning services – gene synthesis, subcloning, mutagenesis, variant library, vector shuttling 
    GenScript: all cDNA clones in your preferred vector (see all 5): BRCA1 (NM_007294)
    Browse Sino Biological Human cDNA Clones
    DNA2.0 Custom Codon Optimized Gene Synthesis Service for BRCA1
    Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat BRCA1 

    Cell Line
    Products:
         
    GenScript Custom overexpressing Cell Line Services for BRCA1
    Search LifeMap BioReagents cell lines for BRCA1

    In Situ Assay
    Products:
       

     
    Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for BRCA1

    Gene Ontology (GO): 5/12 molecular function terms (GO ID links to tree view) (see all 12):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0003677DNA binding TAS9662397
    GO:0003684damaged DNA binding ----
    GO:0003713transcription coactivator activity NAS15572661
    GO:0003723RNA binding IDA12419249
    GO:0004842contributes to ubiquitin-protein ligase activity IDA17349954


    BRCA1 for ontologies           About GeneDecksing


    7 GenomeRNAi human phenotypes for BRCA1:
     Decreased homologous recombina  Decreased viability of wild-ty  Decreased viability with cispl  Increased G1 DNA content 
     Increased cell death HMECs cel  Synthetic lethal with cisplati  Upregulation of Wnt/beta-caten 

    Animal Models:
         Mouse knock-outs for BRCA1: Brca1tm2.1Cxd Brca1tm1Bhk Brca1tm1Mak Brca1tm1Rfo Brca1tm1.1Brn Brca1tm1Whl
                                                   Brca1tm1Cxd Brca1tm1Arge
         15/23 MGI mutant phenotypes (inferred from 18 alleles(MGI details for Brca1) (see all 23):
     adipose tissue  behavior/neurological  cardiovascular system  cellular  digestive/alimentary 
     embryogenesis  endocrine/exocrine gland  growth/size  hematopoietic system  homeostasis/metabolism 
     immune system  integument  limbs/digits/tail  mortality/aging  muscle 

    BRCA1 for phenotypes           About GeneDecksing


    (Pathways according to EMD Millipore, R&D Systems, Cell Signaling Technology, KEGG, PharmGKB, BioSystems, Reactome, Tocris Bioscience, GeneGo (Thomson Reuters), QIAGEN, and/or UniProtKB, Sets of similar genes according to GeneDecks, Interaction Networks according to SABiosciences, and/or STRING, Interactions according to 1UniProtKB, 2MINT, 3I2D, and/or 4STRING, with links to IntAct and Ensembl, Ontologies according to Gene Ontology Consortium 01 Mar 2013 via Entrez Gene).
    About This Section

    Unified GeneCards pathways - 5/40 super-pathways (see all 40About this table 
    See pathways by source

    Super-pathwaycontained gene-specific pathways
    1Meiotic Synapsis
    Meiotic Synapsis1.00
    Chromosome Maintenance0.56
    Meiosis0.70
    Meiotic Recombination0.32
    2Recruitment of repair and signaling proteins to double-strand breaks
    Recruitment of repair and signaling proteins to double-strand breaks1.00
    ATM mediated phosphorylation of repair proteins0.62
    ATM mediated response to DNA double-strand break0.62
    3Homologous Recombination Repair
    Homologous Recombination Repair1.00
    Double-Strand Break Repair0.71
    Homologous recombination repair of replication-independent double-strand breaks1.00
    4Fanconi Anemia pathway
    Fanconi Anemia pathway1.00
    BARD1 signaling events0.23
    Fanconi's Anaemia Pathway0.43
    5Chks in Checkpoint Regulation
    Chks in Checkpoint Regulation1.00
    DNA Repair Mechanisms0.32
    p53 Signaling0.32

    Pathway sources
    See GeneCards unified pathways
    Show all pathways

    5/10 EMD Millipore Pathways for BRCA1 (see all 10)
        DNA damage ATM/ATR regulation of G1/S checkpoint
    Development VEGF signaling and activation
    Meiosis
    Cell cycle Regulation of G1/S transition (part 1)
    DNA damage DNA-damage-induced responses

    5/11 Downloadable PowerPoint Slides of QIAGEN Pathway Central Maps for BRCA1 (see all 11)
        BRCA1 Pathway
    Molecular Mechanisms of Cancer
    JAK-STAT Pathway
    Estrogen Pathway
    DNA Damage Induced 14-3-3Sigma Signaling

    2 Cell Signaling Technology (CST) Pathways for BRCA1
        Cell Cycle / Checkpoint Control
    DNA Damage

    5/8 GeneGo (Thomson Reuters) Pathways for BRCA1 (see all 8)
        DNA damage Role of Brca1 and Brca2 in DNA repair
    DNA damage ATM/ATR regulation of G1/S checkpoint
    DNA damage NHEJ mechanisms of DSBs repair
    Cell cycle Transition and termination of DNA replication
    Cell cycle Regulation of G1/S transition (part 1)

    5/14 BioSystems Pathways for BRCA1 (see all 14
        Integrated Breast Cancer Pathway
    DNA damage response
    Signaling Pathways in Glioblastoma
    Integrated Pancreatic Cancer Pathway
    Integrated Pancreatic Cancer Pathway

    5/15        Reactome Pathways for BRCA1 (see all 15)
        ATM mediated response to DNA double-strand break
    DNA Repair
    Homologous recombination repair of replication-independent double-strand breaks
    Recruitment of repair and signaling proteins to double-strand breaks
    ATM mediated phosphorylation of repair proteins


    1         Kegg Pathway  (Kegg details for BRCA1):
        Ubiquitin mediated proteolysis

    UniProtKB/Swiss-Prot: BRCA1_HUMAN, P38398
    Pathway: Protein modification; protein ubiquitination


    BRCA1 for pathways           About GeneDecksing

    Interactions:

        SABiosciences Gene Network CentralTM Interacting Genes and Proteins Network for BRCA1

    STRING Interaction Network Preview (showing 5 interactants - click image to see 25)

    5/362 Interacting proteins for BRCA1 (P383981, 2, 3 ENSP000003502834) via UniProtKB, MINT, STRING, and/or I2D (see all 362)

    InteractantInteraction Details
    GeneCardExternal ID(s)
    BRIP1Q9BX631, 2, 3, ENSP000002590084EBI-349905,EBI-3509650 MINT-19306 MINT-19307 MINT-5115454 MINT-19369 MINT-5115319 MINT-5115375 MINT-5115552 MINT-19368 MINT-5115303 MINT-5115348 MINT-8141011 MINT-8140834 MINT-8140990 I2D: score=4 STRING: ENSP00000259008
    HIST1H4LP628052, 3, ENSP000003482584MINT-2490745 I2D: score=1 STRING: ENSP00000348258
    HIST1H4AP628052, 3MINT-2490745 I2D: score=1 
    HIST1H4BP628052, 3MINT-2490745 I2D: score=1 
    HIST1H4CP628052, 3MINT-2490745 I2D: score=1 
    About this table

    Gene Ontology (GO): 5/48 biological process terms (GO ID links to tree view) (see all 48):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0000724double-strand break repair via homologous recombination TAS--
    GO:0006260DNA replication ----
    GO:0006281DNA repair TAS--
    GO:0006301postreplication repair IDA17349954
    GO:0006302double-strand break repair TAS--


    BRCA1 for ontologies           About GeneDecksing



    (Chemical Compounds according to UniProtKB, Enzo Life Sciences, EMD Millipore, Tocris Bioscience HMDB, BitterDB, and/or Novoseek, and Drugs according to DrugBank, Enzo Life Sciences, and/or PharmGKB, with drugs/clinical trials/news search links to CenterWatch)
    About This Section

    BRCA1 for compounds           About GeneDecksing

    Browse Small Molecules at EMD Millipore
    Browse drugs & compounds from Enzo Life Sciences

    Browse Tocris compounds for BRCA1
    10/99 Novoseek chemical compound relationships for BRCA1 gene (see all 99)    About this table
    Compound   -log (P-Val)   Hits   PubMed IDs for Articles with Shared Sentences (# sentences)
    estrogen 70.6 284 18377656 (7), 9655254 (7), 8895509 (5), 17505062 (4) (see all 99)
    tamoxifen 57 61 11710890 (7), 18997820 (6), 11870509 (4), 11130383 (4) (see all 29)
    progesterone 56.7 72 18197009 (4), 16109739 (4), 15816544 (3), 11981002 (2) (see all 42)
    mitomycin c 36.7 20 20174566 (3), 14751517 (3), 11406561 (2), 12007633 (1) (see all 9)
    cisplatin 32.9 95 16165098 (6), 19690636 (6), 19270496 (6), 18402708 (6) (see all 31)
    indole-3-carbinol 30.2 13 16434996 (5), 10868478 (2), 16152627 (1), 19622773 (1) (see all 5)
    docetaxel 21.8 23 18402708 (4), 18591931 (3), 19002265 (3), 11400119 (2) (see all 8)
    paclitaxel 21.5 35 16639080 (5), 12717416 (4), 19697632 (3), 19690636 (3) (see all 18)
    sodium bisulfite 20.9 2 17369979 (1), 15252835 (1)
    camptothecin 18.9 10 12955088 (2), 12007633 (1), 15258697 (1), 9679765 (1) (see all 6)

    Search CenterWatch for drugs/clinical trials and news about BRCA1 

    (Secondary structures according to fRNAdb,
    GenBank/EMBL/DDBJ Accessions according to
    Unigene (Build 235 Homo sapiens; Mar 10 2013) or GenBank,
    RefSeq according to Entrez Gene,
    DOTS (version 10), and/or AceView, transcript ids from Ensembl with links to UCSC,
    exon structure from GeneLoc, alternative splicing isoforms according to ASD and/or ECgene,
    RNAi Products from EMD Millipore,
    siRNAs from OriGene, QIAGEN, shRNA from OriGene, microRNA from QIAGEN,
    Tagged/untagged cDNA clones from OriGene, SwitchGear Genomics, GenScript, DNA2.0, Vector BioLabs, Primers from OriGene, SABiosciences, and/or QIAGEN )
    About This Section

    REFSEQ mRNAs for BRCA1 gene (12 alternative transcripts): 
    NM_007294.3  NM_007297.3  NM_007298.3  NM_007299.3  NM_007300.3  NM_007295.2  NM_007296.2  NM_007301.2  
    NM_007302.2  NM_007303.2  NM_007305.2  NM_007306.2  

    Unigene Cluster for BRCA1:

    Breast cancer 1, early onset
    Hs.194143  [show with all ESTs]
    Unigene Representative Sequence: NM_007300
    18/32 Ensembl transcripts including schematic representations, and UCSC links where relevant (see all 32):
    ENST00000357654(uc010whl.2 uc010whm.2 uc002icp.4 uc010whp.2)
    ENST00000468300 ENST00000586385 ENST00000591534 ENST00000591849 ENST00000493795(uc010whq.1)
    ENST00000471181(uc002idc.1 uc010whr.1 uc010cyz.2 uc010cza.2 uc010wht.1)
    ENST00000461221(uc010cyy.1) ENST00000491747 ENST00000484087 ENST00000478531
    ENST00000493919 ENST00000472490 ENST00000487825 ENST00000461574 ENST00000467274(uc002idd.3 uc002ide.1)
    ENST00000412061(uc002icu.3 uc002ict.3 uc002icq.3) ENST00000470026


    miRNA
    Products:
         
    OriGene 3'-UTR Clone (see all 5): BRCA1
    Browse OriGene MicroRNA Expression Plasmids
    QIAGEN Custom miScript Target Protector blocks miRNA-binding site of human, mouse, rat BRCA1
    8/30 QIAGEN miScript miRNA Assays for microRNAs that regulate BRCA1 (see all 30):
    hsa-miR-4291 hsa-miR-3934 hsa-miR-520d-5p hsa-miR-125a-3p hsa-miR-522 hsa-miR-944 hsa-miR-450b-3p hsa-miR-132
    SwitchGear 3'UTR luciferase reporter plasmidBRCA1 3' UTR sequence
    Inhib. RNA
    Products:
         
    EMD Millipore RNAi Products for the Analysis of BRCA1 Gene knock-down
    OriGene 29mer shRNA kits in GFP-retroviral vector in human, mouse, rat for BRCA1 (see all 7)
    OriGene shRNA RFP: BRCA1
    OriGene siRNA: BRCA1
    QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat BRCA1
    Clone
    Products:
         
    OriGene Myc/DDK tagged cDNA clones in CMV expression vector in human, mouse, rat for BRCA1 (see all 10)
    OriGene untagged cDNA clones in CMV expression vector in human, mouse, rat for BRCA1 (see all 8)
    OriGene custom cloning services – gene synthesis, subcloning, mutagenesis, variant library, vector shuttling 
    GenScript: all cDNA clones in your preferred vector (see all 5): BRCA1 (NM_007294)
    DNA2.0 Custom Codon Optimized Gene Synthesis Service for BRCA1
    Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat BRCA1 
    Primer
    Products:
        
    OriGene genome-wide validated SYBR primer pairs in human, mouse, rat for BRCA1
    Browse OriGene validated miRNA SYBR primer pairs
    SABiosciences RT2 qPCR Primer Assay in human, mouse, rat BRCA1
      QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat BRCA1
      QIAGEN QuantiFast Probe-based Assays in human, mouse, rat BRCA1

    Additional cDNA sequence: 

    AB621825.1 AF005068.1 AK293762.1 AK307553.1 AK308084.1 AK316200.1 AY354539.2 AY751490.1 
    BC012577.1 BC030969.1 BC038947.1 BC046142.1 BC062429.1 BC072418.1 BC085615.1 BC106745.1 
    BC106746.1 BC114511.1 BC114562.1 BC115037.1 DQ333386.1 DQ333387.1 DQ363751.1 JN686490.1 
    NR_027676.1 U14680.1 U64805.1 U68041.1 Y08864.1 

    12 DOTS entries:

    DT.313524  DT.91764293  DT.100785659  DT.100785660  DT.100785657  DT.91764294  DT.102831055  DT.120969440 
    DT.86851763  DT.91764295  DT.426829  DT.95149213 

    24/146 AceView cDNA sequences (see all 146):

    BQ215100 BU147444 BG257190 BC072418 BU617173 AW514868 CB158976 AU125312 
    CB108172 AA086435 BM755214 BM988066 BU194336 AU122476 AL043576 AA486004 
    BC030969 BQ683955 BQ676829 BG681276 CB155501 BU155689 CK822699 BM755305 

    GeneLoc Exon Structure

    5/8 Alternative Splicing Database (ASD) splice patterns (SP) for BRCA1 (see all 8)    About this scheme

    ExUns: 1a · 1b · 1c · 1d ^ 2a · 2b ^ 3 ^ 4a · 4b ^ 5a · 5b ^ 6 ^ 7 ^ 8 ^ 9 ^ 10a · 10b · 10c · 10d ^ 11 ^ 12 ^ 13 ^ 14 ^ 15a · 15b ^ 16a ·
    SP1:                    -                                                                                         -                                             
    SP2:                                                  -                                                           -                                             
    SP3:                                                                                                  -     -     -                                             
    SP4:                    -                                                                             -     -     -                                             
    SP5:                                                                                -     -           -     -     -                                             

    ExUns: 16b ^ 17 ^ 18 ^ 19 ^ 20 ^ 21 ^ 22 ^ 23
    SP1:  -                                             
    SP2:  -                                             
    SP3:  -                                             
    SP4:  -                                             
    SP5:  -                                             


    ECgene alternative splicing isoforms for BRCA1

    (RNA expression data according to H-InvDB, NONCODE, miRBase, and RNAdb, Expression images according to data from BioGPS, Illumina Human BodyMap, and CGAP SAGE, Sets of similar genes according to GeneDecks, in vivo and in vitro expression data from LifeMap Discovery™, plus additional links to Genevestigator, and/or SOURCE, and/or BioGPS, and/or UniProtKB,
    PCR Arrays from SABiosciences, Primers from OriGene, SABiosciences, and/or QIAGEN, In Situ Hybridization Assays from Advanced Cell Diagnostics)
    About This Section

    BRCA1 expression in normal human tissues (normalized intensities)
    See probesets specificity/sensitivity at GeneAnnot
    About this imageBioGPS
    CGAP TAG: --

    Microarray
    RNAseq (Illumina Body Map)
    (100×FPKM)½
    SAGE (Serial Analysis of Gene Expression)

    About this image

    BRCA1 expression in embryonic tissues and stem cells
    Expression by the Database of Embryonic development, Stem cell research, and Regenerative medicine    About this table
    1 LifeMap In Vivo Development Anatomical Compartment/Cell 
    Tissue Anatomical Compartment CellCategory (developmental path)
    TestisSeminiferous TubulesPrimary SpermatocyteGerm Cells, Male Gametocytes
    Expression: Positive    Negative     Selective marker
    Experimental details: Curated     Microarrays     In-situ hybridization

    See BRCA1 Protein Expression from SPIRE MOPED and PaxDB
    Genevestigator expression for BRCA1

    SOURCE GeneReport for Unigene cluster: Hs.194143

    UniProtKB/Swiss-Prot: BRCA1_HUMAN, P38398
    Tissue specificity: Isoform 1 and isoform 3 are widely expressed. Isoform 3 is reduced or absent in several breast and
    ovarian cancer cell lines

        SABiosciences Expression via Pathway-Focused PCR Arrays including BRCA1 (see all 13): 
              Oncogenes & Tumor Suppressor Genes in human mouse rat
              DNA Damage Signaling Pathway in human mouse rat
              Ubiquitin Ligases in human mouse rat
              cAMP / Ca2+ Signaling PathwayFinder in human mouse rat
              Ubiquitination (Ubiquitylation) Pathway in human mouse rat

    Primer
    Products:
    OriGene genome-wide validated SYBR primer pairs in human, mouse, rat for BRCA1
    Browse OriGene validated miRNA SYBR primer pairs
    SABiosciences RT2 qPCR Primer Assay in human, mouse, rat BRCA1
    QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat BRCA1
    QIAGEN QuantiFast Probe-based Assays in human, mouse, rat BRCA1
    In Situ
    Assay Products:
     

     
    Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for BRCA1

    (Orthologs according to 1,2HomoloGene (2older version, for species not in 1newer version), 3euGenes, 4SGD , 5MGI Mar 06 2013, with possible further links to Flybase and/or WormBase, and/or 6Ensembl pan taxonomic compara , Gene Trees according to Ensembl and TreeFam)
    About This Section

    This gene was present in the common ancestor of eukaryotes.

    Orthologs for BRCA1 gene from 7/21 species (see all 21)    About this table
    Organism Taxonomic
    classification
    Gene Description Human
    Similarity
    Orthology
    Type
    Details
    mouse
    (Mus musculus)
    Mammalia Brca11 , 5 breast cancer 11, 5 74.35(n)1
    58.11(a)1
      11 (65.18 cM)5
    121891  NM_009764.31  NP_033894.31 
     1014887645 
    chicken
    (Gallus gallus)
    Aves BRCA11 breast cancer 1, early onset 50.01(n)
    34.28(a)
      373983  NM_204169.1  NP_989500.1 
    lizard
    (Anolis carolinensis)
    Reptilia --
    BRCA16
    --
    25(a)
    20(a)
    1 ↔ 1
    possible ortholog
    6(62757826-62799296)
    6(62800188-62816453)
    African clawed frog
    (Xenopus laevis)
    Amphibia Xl.121052 Xenopus laevis breast and ovarian cancer susceptibility more 79.05(n)    AF416868.1 
    honey bee
    (Apis mellifera)
    Insecta --
    --
    16(a)
    1 ↔ 1
    Group9.13(148896-157366)
    thale cress
    (Arabidopsis thaliana)
    eudicotyledons BARD16
    ATBRCA16
    BRCA1-associated RING domain protein 1
    protein BREAST CANCER SUSCEPTIBILITY 1-like protei...
    16(a)
    13(a)
    many → 1
    many → 1
    1(1036537-1040224)
    4(11248078-11252724)
    rice
    (Oryza sativa)
    Liliopsida --
    --
    (see all 3)
    BRCA1 C Terminus domain containing protein, expres...
    BRCA1 C Terminus domain containing protein, expres...
    (see all 3)
    15(a)
    14(a)
    (see all 3)
    many → 1
    many → 1
    (see all 3)
    4(25426534-25430685)
    5(23868815-23874371)


    ENSEMBL Gene Tree for BRCA1 (if available)
    TreeFam Gene Tree for BRCA1 (if available) 

    (Paralogs according to 1HomoloGene,
    2Ensembl, and 3SIMAP, Pseudogenes according to 4Pseudogene.org Build 68)
    About This Section
      --

    (SNPs/Variants according to the 1NCBI SNP Database, 2Ensembl, 3PupaSUITE, UniProtKB, and DNA2.0, Linkage Disequilibrium by HapMap, Structural Variations(CNVs/InDels/Inversions) from the Database of Genomic Variants, Mutations from the Human Gene Mutation Database (HGMD) and the Locus Specific Mutation Databases (LSDB), Blood group antigen gene mutations by BGMUT, Resequencing Primers from QIAGEN, Cancer Mutation PCR Arrays and Assays and Copy Number PCR Arrays from SABiosciences)
    About This Section

    UniProtKB/Swiss-Prot: BRCA1_HUMAN, P38398
    Polymorphism: There is evidence that the presence of the rare form of Gln-356-Arg and Leu-871-Pro polymorphisms may be
    associated with an increased risk for developing ovarian cancer


    10/2951 NCBI SNPs in BRCA1 are shown (see all 2951    About this table
    Genomic DataTranscription Related DataAllele Frequencies
    SNP IDValidClinical
    significance
    Chr 17 posSequence#AA
    Chg
    TypeMore#Allele
    freq
    PopTotal
    sample
    More
    ----------
    rs2018669971,2
    C,untested37284997(+) AACACA/GTTAGA 6 -- int1 us2k10--------
    rs803571111,2
    Cuntested37285027(-) AGAAAC/G/TGGATT 16 T R M mis1 ut510--------
    rs803569291,2
    Cuntested37285078(-) TGCTAA/C/TGCAGA 16 K T M mis1 ut510--------
    rs803580101,2
    Cuntested37285106(-) ATCTGA/C/G/
            
    TAAGT
    6 -- spd10--------
    rs1932144691,2
    C,untested37293197(+) AATGTC/TTGCTG 6 -- int10--------
    rs563280131,2
    C,untested37293334(-) CCCCCA/C/GCTACC 6 -- int10--------
    rs803580551,2
    C,untested37293335(-) CCCCCC/GTACCC 6 -- int10--------
    rs803568801,2
    Cuntested37293376(-) CTCCAA/C/GAAAGT 15 K T R mis1 int10--------
    rs18000621,2
    C,F,H,untested37293380(-) ACAAAA/G/TTGTGA 15 K N syn1 mis1 int110NS EA NA 1074
    rs803571641,2
    Cuntested37293381(-) CAAAGA/C/TGTGAC 15 S R C mis1 int10--------

    HapMap Linkage Disequilibrium report for BRCA1 (41196312 - 41322290 bp)
    Structural Variations (Copy Number Variations, Insertions/Deletions, Inversions)
          Database of Genomic Variants (DGV) variations for BRCA1: --
    Human Gene Mutation Database (HGMD): BRCA1

    Locus Specific Mutation Databases (LSDB): BRCA1

    3 SABiosciences Cancer Mutation PCR Assays for BRCA1:
    Cosmic IdAA Change
    23943p.V757fs*8
    23941p.?
    13841p.L30F
    QIAGEN SeqTarget long-range PCR primers in human, mouse, rat for resequencing BRCA1
    DNA2.0 Custom Variant and Variant Library Synthesis for BRCA1

    (in which this Gene is Involved, According to MalaCards, OMIM, UniProtKB, the University of Copenhagen DISEASES database, Novoseek, Genatlas, GeneTests, GAD, HuGE Navigator, and/or TGDB.)
    About This Section

    BRCA1 for disorders           About GeneDecksing

    OMIM gene information: 113705   
    OMIM disorders: 604370  
    UniProtKB/Swiss-Prot: BRCA1_HUMAN, P38398
  • Defects in BRCA1 are a cause of susceptibility to breast cancer (BC) [MIM:114480]. A common malignancy
  • originating from breast epithelial tissue. Breast neoplasms can be distinguished by their histologic pattern. Invasive
    ductal carcinoma is by far the most common type. Breast cancer is etiologically and genetically heterogeneous.
    Important genetic factors have been indicated by familial occurrence and bilateral involvement. Mutations at more than
    one locus can be involved in different families or even in the same case. Note=Mutations in BRCA1 are thought to be
    responsible for 45% of inherited breast cancer. Moreover, BRCA1 carriers have a 4-fold increased risk of colon cancer,
    whereas male carriers face a 3-fold increased risk of prostate cancer. Cells lacking BRCA1 show defects in DNA repair
    by homologous recombination
  • Defects in BRCA1 are a cause of susceptibility to familial breast-ovarian cancer type 1 (BROVCA1)
  • [MIM:604370]. A condition associated with familial predisposition to cancer of the breast and ovaries. Characteristic
    features in affected families are an early age of onset of breast cancer (often before age 50), increased chance of
    bilateral cancers (cancer that develop in both breasts, or both ovaries, independently), frequent occurrence of breast
    cancer among men, increased incidence of tumors of other specific organs, such as the prostate. Note=Mutations in
    BRCA1 are thought to be responsible for more than 80% of inherited breast-ovarian cancer
  • Defects in BRCA1 are a cause of susceptibility to ovarian cancer (OC) [MIM:167000]. The term ovarian cancer
  • defines malignancies originating from ovarian tissue. Although many histologic types of ovarian tumors have been
    described, epithelial ovarian carcinoma is the most common form. Ovarian cancers are often asymptomatic and the
    recognized signs and symptoms, even of late-stage disease, are vague. Consequently, most patients are diagnosed with
    advanced disease
  • Defects in BRCA1 are a cause of susceptibility to pancreatic cancer type 4 (PNCA4) [MIM:614320]. A malignant
  • neoplasm of the pancreas. Tumors can arise from both the exocrine and endocrine portions of the pancreas, but 95% of
    them develop from the exocrine portion, including the ductal epithelium, acinar cells, connective tissue, and
    lymphatic tissue

    20/125 diseases for BRCA1 (see all 125):    About MalaCards
    breast-ovarian cancer    ovarian cancer    breast cancer    li-fraumeni syndrome
    von hippel-lindau disease    estrogen-receptor positive breast cancer    fallopian tube carcinoma    fallopian tube cancer
    nijmegen breakage syndrome    breast-ovarian cancer, familial, 1    radiation induced cancer    diffuse large b-cell lymphoma
    familial adenomatous polyposis    neural tube defect    xeroderma pigmentosum    dna topoisomerase ii
    papillary serous carcinoma of the peritoneum    premature menopause    b-cell lymphomas    cystadenoma

    10 diseases from the University of Copenhagen DISEASES database for BRCA1:
    Ovarian cancer     Breast cancer     Fanconi's anemia     Fallopian tube cancer
    Autosomal dominant disease     Carcinoma     Peritoneal carcinoma     Ataxia telangiectasia
    Ductal carcinoma in situ     Prostate cancer

    10/95 Novoseek disease relationships for BRCA1 gene (see all 95)    About this table

    Disease   -log (P-Val)   Hits   PubMed IDs for Articles with Shared Sentences (# sentences)
    ovarian cancer 95.8 2220 10560359 (7), 9796975 (7), 20223018 (7), 10978226 (6) (see all 99)
    breast cancer 93.5 4077 15564800 (9), 20223018 (9), 11710890 (8), 11044354 (8) (see all 99)
    germ-line mutation 91.3 221 17001151 (4), 8875917 (4), 10969800 (3), 16085232 (3) (see all 99)
    prophylactic oophorectomy 90.9 57 15863145 (6), 10469748 (5), 9148160 (3), 12023993 (3) (see all 39)
    bilateral breast cancer 85.2 38 11556836 (3), 10573018 (2), 17557253 (2), 19372713 (2) (see all 25)
    cancer 82.6 997 14966099 (7), 12237281 (5), 10972993 (4), 12237282 (4) (see all 99)
    breast carcinoma 75.1 214 9840533 (5), 9241077 (4), 9699523 (4), 11859870 (3) (see all 99)
    fanconis anemia 74.6 23 12483114 (2), 12967657 (2), 16116421 (2), 15726604 (1) (see all 19)
    tumors 73.4 1603 15868446 (10), 11773283 (8), 10686936 (8), 15712267 (7) (see all 99)
    ovarian carcinoma 72.7 115 10686936 (5), 16284991 (4), 10388472 (3), 9661879 (3) (see all 65)

    Genatlas disease: BRCA1
    breast carcinoma,early onset,high tumor grade,negative estrogen and progesterone receptor status,and high
    proliferative rate,breast ovarian cancer family,familial site-specific ovarian cancer,Lynch syndrome II (see
    TSG17B),excluding familial male breast cancer,including early onset gastric carcinoma,not frequently prostate
    carcinomas

    GeneTests: BRCA1
    BRCA1 and BRCA2 Hereditary Breast/Ovarian Cancer

    Genetic Association Database (GAD): BRCA1
    Human Genome Epidemiology (HuGE) Navigator: BRCA1 (824 documents)
    Tumor Gene Database (TGDB): BRCA1

    Export disorders for BRCA1 gene to outside databases

    (in PubMed. Associations of this gene to articles via 1Entrez Gene, 2UniProtKB/Swiss-Prot, 3HGNC, 4GAD, 5PharmGKB, 6HMDB, 7DrugBank, 8UniProtKB/TrEMBL, 9 Novoseek, and/or 10fRNAdb)
    About This Section

    PubMed articles for BRCA1 gene, integrated from 9 sources (see all 2966):
    (articles sorted by number of sources associating them with BRCA1)
        Utopia: connect your pdf to the dynamic
    world of online information

    1. One in 10 ovarian cancer patients carry germ line BRCA1 or BRCA2 mutations: results of a prospective study in Southern Sweden. (PubMed id 14746861)1, 2, 4, 9 Malander S.... Borg A. (2004)
    2. A comprehensive model for familial breast cancer incorporating BRCA1, BRCA2 and other genes. (PubMed id 11857015)1, 4, 9 Antoniou A.C....Easton D.F. (2002)
    3. [Mutational analysis of BRCA1 and BRCA2 genes in early-onset breast cancer patients in Shanghai] (PubMed id 16324400)1, 4, 9 Song C.G....Shao Z.M. (2005)
    4. Novel germline mutations in the BRCA1 and BRCA2 genes in Indian breast and breast-ovarian cancer families. (PubMed id 14722926)1, 2, 9 Valarmathi M.T.... Das S.N. (2004)
    5. Germline BRCA1 mutations predispose to pancreatic adenocarcinoma. (PubMed id 18762988)1, 2, 9 Al-Sukhni W....Gallinger S. (2008)
    6. Breast cancer risk and the DNA double-strand break end-joining capacity of nonhomologous end-joining genes are affected by BRCA1. (PubMed id 15256476)1, 4, 9 Bau D.T....Shen C.Y. (2004)
    7. Functional interactions between BRCA1 and the checkpoint kinase ATR during genotoxic stress. (PubMed id 11114888)1, 2, 9 Tibbetts R.S.... Abraham R.T. (2000)
    8. [Germline mutations in the BRCA1 and BRCA2 genes from breast cancer families in China Han people] (PubMed id 15059511)1, 4, 9 Zhou Y.Z....Fang F.D. (2004)
    9. A combined analysis of outcome following breast cancer: differences in survival based on BRCA1/BRCA2 mutation status and administration of adjuvant treatment. (PubMed id 14680495)1, 4, 9 Robson M.E....Foulkes W.D. (2004)
    10. BACH1, a novel helicase-like protein, interacts directly with BRCA1 and contributes to its DNA repair function. (PubMed id 11301010)1, 2, 9 Cantor S.B....Livingston D.M. (2001)

    (in PubMed, OMIM, and NCBI Bookshelf)
    About This Section
     ANDOR
    Aliases
    Disorders
    Free Text  

      Query String
    PubMed
    OMIM
    NCBI Bookshelf
      (Note: In FireFox, select the above section and copy using Ctrl-C)

    (According to Entrez Gene, HGNC, AceView, euGenes, Ensembl, miRBase, ECgene, Kegg, and/or H-InvDB)
    About This Section
    Entrez Gene: 672 HGNC: 1100 AceView: BRCA1 Ensembl:ENSG00000012048 euGenes: HUgn672
    ECgene: BRCA1 Kegg: 672 H-InvDB: BRCA1

    (According to HUGE)
    About This Section
      --

    (According to PharmGKB, ATLAS, HORDE, IMGT, LEIDEN, UniProtKB/Swiss-Prot, and/or UniProtKB/TrEMBL,
    Wikipedia and/or GeneReviews via UniProtKB/Swiss-Prot)
    About This Section
    NameDescription
    PharmGKB entry for BRCA1 Pharmacogenomics, SNPs, Pathways
    ATLAS Chromosomes in Cancer entry for BRCA1 Genetics and Cytogenetics in Oncology and Haematology
    GeneReviewshttp://www.ncbi.nlm.nih.gov/sites/GeneTests/lab/gene/BRCA1
    NIEHS-SNPshttp://egp.gs.washington.edu/data/brca1/
    SHMPDhttp://shmpd.bii.a-star.edu.sg/gene.php?genestart=A&genename=BRCA1
    Wikipedia http://en.wikipedia.org/wiki/BRCA1

    (Patent information from GeneIP,
    Licensable technologies from WIS Yeda, Salk, Tufts,
    IP news from LifeMap Sciences, Inc.)
    About This Section
    Patent Information for BRCA1 gene:
    Search GeneIP for patents involving BRCA1

    GeneCards and IP:
    Japan Patent Office Licenses GeneCards     European Patent Office Licenses GeneCards     Improving the IP Search



    (Antibodies, recombinant proteins, and assays from EMD Millipore, R&D Systems, OriGene, QIAGEN, GenScript, Cell Signaling Technology, SABiosciences, Novus Biologicals, Sino Biological, Enzo Life Sciences, Abcam, ProSpec, Uscn, Thermo Fisher Scientific, Gene Editing from DNA2.0, Clones from EMD Millipore, OriGene, GenScript, Sino Biological, DNA2.0, SwitchGear Genomics, Vector BioLabs, Cell lines from GenScript and LifeMap BioReagents, PCR Arrays from SABiosciences, Drugs and/or compounds from EMD Millipore, Tocris Bioscience, and/or Enzo Life Sciences),
    In Situ Hybridization Assays from
    Advanced Cell Diagnostics
    About This Section

     Browse Purified and Recombinant Proteins at EMD Millipore
     EMD Millipore Kits and Assays for the Analysis of BRCA1
     EMD Millipore Mono- and Polyclonal Antibodies for the study of BRCA1
     EMD Millipore RNAi Products for the Analysis of BRCA1 Gene knock-down
     Browse Small Molecules at EMD Millipore
     Browse Clones for the Expression of Recombinant Proteins Available from EMD Millipore
     
     EMD Millipore Custom Antibody & Bulk Services
     EMD Millipore Preclinical / Clinical Development Services
     EMD Millipore Immunoassay Services
     EMD Millipore Target Screening & Profiling Services

      
     Antibodies for BRCA1 (BRCA1)   Browse Cell Culture Products  
     Browse ELISAs   Browse Flow Cytometry Kits  
     Browse Primer Pairs   Browse Kinase Activity Assays/Reagents  
     Browse ELISpot Kits/Development Modules   Browse TFB/Immunoprecipitation Assays  
     Browse Apoptosis Detection Kits/Reagents   Browse Ubiquitin Proteasome Pathway (UPP) Assay Kits/Reagents  
     Browse DNA Damage/Repair Kits/Reagents   Browse Multiplex/Array Assay Kits/Reagents  
     Browse Cell Selection/Detection Kits/Reagents   Browse Secondary Antibodies/Controls/Staining Reagents  
     Browse Phosphatase Activity Assays/Reagents   Browse Recombinant/Natural Proteins  
     OriGene Antibodies for BRCA1   OriGene shRNA RFP for BRCA1  
     OriGene 29mer shRNA kits in GFP-retroviral vector in human, mouse, rat for BRCA1   OriGene genome-wide validated SYBR primer pairs in human, mouse, rat for BRCA1  
     Browse OriGene Protein Over-expression Lysates   Browse OriGene Fluorogenic Cell Assay Kits  
     OriGene siRNA for BRCA1   OriGene 3'-UTR Clone for BRCA1  
     OriGene untagged cDNA clones in CMV expression vector in human, mouse, rat for BRCA1   OriGene Myc/DDK tagged cDNA clones in CMV expression vector in human, mouse, rat for BRCA1  
     Browse OriGene GFP tagged cDNA clones in CMV expression vector   Browse OriGene MicroRNA Expression Plasmids  
     Browse OriGene basic RS shRNAs   Browse OriGene validated miRNA SYBR primer pairs  
     Browse OriGene full length recombinant human proteins expressed in human HEK293 cells   OriGene custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling  
     OriGene Custom Antibody Services for BRCA1   OriGene Custom Protein Services for BRCA1  
     OriGene Custom Immunoassay Development  

     
     
     QIAGEN Custom miScript Target Protector blocks miRNA-binding site of in human, mouse, rat BRCA1
     QIAGEN SeqTarget long-range PCR primers in human, mouse, rat for resequencing BRCA1
     QIAGEN PyroMark CpG Assay predesigned Pyrosequencing DNA Methylation assays in human, mouse, rat BRCA1
     QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat BRCA1
     QIAGEN QuantiFast Probe-based Assays in human, mouse, rat BRCA1
     QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat BRCA1
     GenScript Custom Purified and Recombinant Proteins Services for BRCA1 GenScript cDNA clones with any tag delivered in your preferred vector for BRCA1
     GenScript Custom Assay Services for BRCA1 GenScript Superior Antibodies for BRCA1
     GenScript Custom overexpressing Cell Line Services for BRCA1 CloneReady with Over 120,000 Genes
     Gene Synthesis: Any Gene in Any Vector Vector-based siRNA and miRNA, Ready for Transfection
     Gene Mutant Library, Variants up to 10^11 Plasmid Preparation
     Custom Peptide Services
     Antibodies & Assays for BRCA1 

     Regulatory tfbs in BRCA1 promoter
     Search Chromatin IP Primers for BRCA1
     RT2 qPCR Primer Assay in human, mouse, rat BRCA1
     GNC Network for BRCA1
     SABiosciences PCR Arrays including human, mouse, rat BRCA1
     Search Tocris compounds for BRCA1
     Browse Sino Biological Proteins and Antibodies
     Browse Sino Biological cDNA Clones
     Antibodies/Proteins Production Services
     Rabbit Monoclonal Antibody Platform
     Bulk Purchasing
     Search www.enzolifesciences.com for proteins, assays, substrates, inhibitors & antibodies
     Novus Tissue Slides
     BRCA1 antibodies
     BRCA1 proteins
     Search for Antibodies for BRCA1 at Abcam
     See all of Abcam's Antibodies, Kits and Proteins for BRCA1
     Custom Antibody / Protein Production Service
     Bulk Purchasing
     Advantages of Rabbit Monoclonal antibodies
     Abcam protocols and scientific support
     Browse ProSpec Recombinant Proteins




     BRCA1 Proteins, Antibodies, CLIAs, and ELISAs
     Search LifeMap BioReagents cell lines for BRCA1
     Gene Synthesis
     Protein Engineering
     Variant Library Synthesis
     Codon Optimization
     Protein Production and Purification
     Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for BRCA1
     SwitchGear 3'UTR luciferase reporter plasmids for BRCA1
     SwitchGear Promoter luciferase reporter plasmids for BRCA1
     ThermoFisher Antibodies for BRCA1
     Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat BRCA1
           
    GeneCards Homepage - Last full update: 18 Mar 2013 - Incrementals: 21 Mar 2013 , 15 Apr 2013 , 27 Apr 2013

    View Random Gene

    Category
    VWF
    (GIFTS: 73)
    von Willebrand factor
    GIFtS Group
    The GeneCards human gene database gene index: 1 3 5 6 A B C D E F G H I J K L M N O P Q R S T U V W X Y Z 


    Developed at the Crown Human Genome Center, Department of Molecular Genetics, the Weizmann Institute of Science

    Hot genes      Disease genes      BRCA1 gene at Home site.
    hostname: 356980-web2.xennexinc.com index build: 100 solr: 1.4