Set Analyses:
Advanced Search

Advanced Search

 
Search By
Section (entire)
for


 
or upload a file of gene symbols


Category   Symbol Source: HGNC EntrezGene Ensembl GeneCards RNA genes CroW21
GIFtS

BPNT1 Gene

protein-coding   GIFtS: 57
GCID: GC01M220230

3'(2'), 5'-bisphosphate nucleotidase 1

 Explore 3 diseases affiliated with
BPNT1 via our new
 Human Malady Compendium 
Biological research products
for BPNT1
    

(According to 1HGNC, 2Entrez Gene,
3UniProtKB/Swiss-Prot, 4UniProtKB/TrEMBL, 5OMIM, 6GeneLoc, 7Ensembl, 8DME, 9miRBase, and/or 10fRNAdb)
About This Section

Aliases
3'(2'), 5'-Bisphosphate Nucleotidase 11 2     3'(2'),5'-Bisphosphate Nucleotidase 12
Bisphosphate 3'-Nucleotidase 12 3     BPntase2
PIP2 3     PAP-Inositol-1,4-Phosphatase1
PAP-Inositol 1,4-Phosphatase2 3     EC 3.1.38
EC 3.1.3.73 8     

External Ids:    HGNC: 10961   Entrez Gene: 103802   Ensembl: ENSG000001628137   OMIM: 6040535   UniProtKB: O958613   

Export aliases for BPNT1 gene to outside databases

Previous GC identifers: GC01M218827 GC01M216074 GC01M216777 GC01M217287 GC01M216619 GC01M218297 GC01M190905


(According to Entrez Gene, Tocris Bioscience, Wikipedia's Gene Wiki, PharmGKB,
UniProtKB/Swiss-Prot, and/or UniProtKB/TrEMBL)
About This Section

Entrez Gene summary for BPNT1:
BPNT1, also called bisphosphate 3-prime-nucleotidase, or BPntase, is a member of a magnesium-dependent
phosphomonoesterase family. Lithium, a major drug used to treat manic depression, acts as an uncompetitive inhibitor
of BPntase. The predicted human protein is 92% identical to mouse BPntase. BPntase's physiologic role in nucleotide
metabolism may be regulated by inositol signaling pathways. The inhibition of human BPntase may account for
lithium-induced nephrotoxicity. (provided by RefSeq, Jul 2008)

UniProtKB/Swiss-Prot: BPNT1_HUMAN, O95861
Function: Converts adenosine 3'-phosphate 5'-phosphosulfate (PAPS) to adenosine 5'-phosphosulfate (APS) and
3'(2')-phosphoadenosine 5'- phosphate (PAP) to AMP. Has 1000-fold lower activity towards inositol 1,4-bisphosphate
(Ins(1,4)P2) and inositol 1,3,4-trisphosphate (Ins(1,3,4)P3), but does not hydrolyze Ins(1)P, Ins(3,4)P2,
Ins(1,3,4,5)P4 or InsP6




(According to GeneLoc and/or HGNC, and/or
Entrez Gene (NCBI build 37),
and/or miRBase,
Genomic Views according to UCSC (hg19) and Ensembl (release 69), Regulatory elements and Epigenetics data according to QIAGEN, SABiosciences, and/or SwitchGear Genomics)
About This Section
RefSeq DNA sequence:
NC_000001.10  NC_018912.1  NT_167186.1  
Regulatory elements:
   SABiosciences Regulatory transcription factor binding sites in the BPNT1 gene promoter:
         FOXD3   Ik-3   GATA-2   Arnt   GATA-1   HEN1   POU2F1   POU2F1a   FOXJ2 (long isoform)   FOXJ2   
         Other transcription factors

SwitchGear Promoter luciferase reporter plasmidBPNT1 promoter sequence
   Search SABiosciences Chromatin IP Primers for BPNT1

Epigenetics:
QIAGEN PyroMark CpG Assay predesigned Pyrosequencing DNA Methylation assays in human, mouse, rat BPNT1


Genomic Location:
Genomic View: UCSC Golden Path with GeneCards custom track

Entrez Gene cytogenetic band: 1q41   Ensembl cytogenetic band:  1q41   HGNC cytogenetic band: 1q42

BPNT1 Gene in genomic location: bands according to Ensembl, locations according to (and/or Entrez Gene and/or Ensembl if different)
BPNT1 gene location

GeneLoc information about chromosome 1         GeneLoc Exon Structure

GeneLoc location for GC01M220230:  view genomic region     (about GC identifiers)

Start:
220,230,824 bp from pter      End:
220,263,804 bp from pter
Size:
32,981 bases      Orientation:
minus strand

(According to 1UniProtKB, HORDE, neXtProt, Ensembl, and/or Reactome, Modification sites according to 2PhosphoSitePlus, Specific Peptides from DME, Protein expression images according to data from SPIRE MOPED and PaxDb, RefSeq according to NCBI, PDB rendering according to OCA and/or Proteopedia, Recombinant Proteins from EMD Millipore, R&D Systems, GenScript, Enzo Life Sciences, OriGene, Novus Biologicals, Sino Biological, ProSpec, and/or Uscn,
Biochemical Assays by EMD Millipore, R&D Systems, OriGene, GenScript, Cell Signaling Technology, Enzo Life Sciences, and/or Uscn, Ontologies according to Gene Ontology Consortium 01 Mar 2013 and Entrez Gene, Antibodies by EMD Millipore, R&D Systems, GenScript, Cell Signaling Technology, OriGene, Novus Biologicals, Thermo Fisher Scientific, Abcam, and/or Uscn)
About This Section

UniProtKB/Swiss-Prot: BPNT1_HUMAN, O95861 (See protein sequence)
Recommended Name: 3'(2'),5'-bisphosphate nucleotidase 1  
Size: 308 amino acids; 33392 Da
Cofactor: Magnesium
1 PDB 3D structure from and Proteopedia for BPNT1:
2WEF (3D)    
Secondary accessions: A8K7C8 D3DTA9 Q8WVL5 Q9UGJ3
Alternative splicing: 2 isoforms:  O95861-1   O95861-2   (No experimental confirmation available)

Explore the universe of human proteins at neXtProt for BPNT1: NX_O95861

Post-translational modifications:

  • View modification sites using PhosphoSitePlus2
  • View neXtProt modification sites for NX_O95861

  • 4 DME Specific Peptides for BPNT1 (O95861)
     VWVDPLD  AVGGKLTD  EEILKQPCPSQYSAIKEEDLVVWVDP  VLRVGGAGNKIIQLIEGKASAYVFASPGCKKWDTCAPEVIL 

    BPNT1 Protein expression data from MOPED and PaxDb:    About this image 
    Estimated protein expression log10 (pmol).

    REFSEQ proteins: NP_006076.4  
    ENSEMBL proteins: 
     ENSP00000446828   ENSP00000346862   ENSP00000446953   ENSP00000446850   ENSP00000448740  
     ENSP00000449883   ENSP00000318852   ENSP00000410348   ENSP00000444398  
    Reactome Protein details: O95861
    Human Recombinant Protein Products: 
    Browse Purified and Recombinant Proteins at EMD Millipore
    Browse R&D Systems for human recombinant proteins
    Browse recombinant and purified proteins available from Enzo Life Sciences
    OriGene Purified Protein: BPNT1
    OriGene Protein Over-expression Lysate: BPNT1
    OriGene Custom Protein Services for BPNT1 
    GenScript Custom Purified and Recombinant Proteins Services for BPNT1
    Novus Biologicals BPNT1 Proteins
    Novus Biologicals BPNT1 Lysates
    Browse Sino Biological Recombinant Proteins
    ProSpec Recombinant Protein for BPNT1
    Uscn Proteins for BPNT1

    Gene Ontology (GO): 1 cellular component term (GO ID links to tree view):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0005829cytosol TAS--


    BPNT1 for ontologies           About GeneDecksing



    BPNT1 Antibody Products: 
    Browse EMD Millipore's Extensive Line of Mono- and Polyclonal Antibodies
    Browse R&D Systems for Antibodies
    OriGene Antibodies: BPNT1
    OriGene Custom Antibody Services for BPNT1 
    GenScript Custom Superior Antibodies Services for BPNT1
    Novus Biologicals BPNT1 Antibodies
    Search for Antibodies for BPNT1 at Abcam  
    Uscn Antibodies for BPNT1
    ThermoFisher Antibodies for BPNT1

    Assay Products for BPNT1: 
    Browse Kits and Assays available from EMD Millipore
    OriGene Custom Immunoassay Development
    Browse OriGene Fluorogenic Cell Assay Kits
    Browse R&D Systems for biochemical assays
    GenScript Custom Assay Services for BPNT1
    Browse Enzo Life Sciences for kits & assays
    Uscn ELISAs and CLIAs for BPNT1


    (According to InterPro, ProtoNet, UniProtKB, and/or BLOCKS, Sets of similar genes according to GeneDecks)
    About This Section

    BPNT1 for domains           About GeneDecksing

    3 InterPro domains/families:
     IPR020550 Inositol_monophosphatase_CS
     IPR000760 Inositol_monophosphatase
     IPR020583 Inositol_monoP_metal-BS

    Graphical View of Domain Structure for InterPro Entry O95861

    ProtoNet protein and cluster: O95861

    UniProtKB/Swiss-Prot: BPNT1_HUMAN, O95861
    Similarity: Belongs to the inositol monophosphatase family


    (According to 1UniProtKB, Genatlas, LifeMap Discovery™, IUBMB, and/or 2DME, Human phenotypes from GenomeRNAi, Animal models from MGI Mar 06 2013,
    bound targets from SABiosciences, miRNA Gene Targets from miRTarBase shRNA from OriGene, RNAi from EMD Millipore, siRNAs from OriGene, QIAGEN, microRNA from QIAGEN, Gene Editing from DNA2.0, Clones from EMD Millipore, OriGene, SwitchGear Genomics, GenScript, Sino Biological, DNA2.0, and Vector BioLabs, Cell Lines from GenScript, LifeMap BioReagents, In Situ Hybridization Assays from Advanced Cell Diagnostics, Ontologies according to Gene Ontology Consortium 01 Mar 2013 via Entrez Gene.)
    About This Section

    Function Summary:

         UniProtKB/Swiss-Prot: BPNT1_HUMAN, O95861
    Function: Converts adenosine 3'-phosphate 5'-phosphosulfate (PAPS) to adenosine 5'-phosphosulfate (APS) and
    3'(2')-phosphoadenosine 5'- phosphate (PAP) to AMP. Has 1000-fold lower activity towards inositol 1,4-bisphosphate
    (Ins(1,4)P2) and inositol 1,3,4-trisphosphate (Ins(1,3,4)P3), but does not hydrolyze Ins(1)P, Ins(3,4)P2,
    Ins(1,3,4,5)P4 or InsP6
    Catalytic activity: Adenosine 3',5'-bisphosphate + H(2)O = adenosine 5'-phosphate + phosphate
    Enzyme regulation: Uncompetitive inhibition by micromolar concentrations of lithium. Competitive inhibition by inositol
    1,4-bisphosphate

    Enzyme Numbers (IUBMB): EC 3.1.3.71 2 EC 3.1.32

    miRNA
    Products:
        
    OriGene 3'-UTR Clone: BPNT1
    Browse MicroRNA Expression Plasmids
    QIAGEN Custom miScript Target Protector blocks miRNA-binding site of human, mouse, rat BPNT1
    5 QIAGEN miScript miRNA Assays for microRNAs that regulate BPNT1:
    hsa-miR-607 hsa-miR-206 hsa-miR-613 hsa-miR-1 hsa-miR-1305
    SwitchGear 3'UTR luciferase reporter plasmidBPNT1 3' UTR sequence
    Inhib. RNA
    Products:
        
    Browse for Gene Knock-down Tools from EMD Millipore
    OriGene 29mer shRNA kits in GFP-retroviral vector in human, mouse, rat for BPNT1 (see all 7)
    OriGene shRNA RFP: BPNT1
    OriGene siRNA: BPNT1
    QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat BPNT1

    Gene Editing
    Products:
    DNA2.0 Custom Protein Engineering Service for BPNT1

    Clone
    Products:
         
    Browse Clones for the Expression of Recombinant Proteins Available from EMD Millipore
    OriGene Myc/DDK tagged cDNA clones in CMV expression vector in human, mouse, rat for BPNT1 (see all 3)
    OriGene untagged cDNA clones in CMV expression vector in human, mouse, rat for BPNT1 (see all 3)
    OriGene custom cloning services – gene synthesis, subcloning, mutagenesis, variant library, vector shuttling 
    GenScript: all cDNA clones in your preferred vector: BPNT1 (NM_006085)
    Browse Sino Biological Human cDNA Clones
    DNA2.0 Custom Codon Optimized Gene Synthesis Service for BPNT1
    Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat BPNT1 

    Cell Line
    Products:
         
    GenScript Custom overexpressing Cell Line Services for BPNT1
    Search LifeMap BioReagents cell lines for BPNT1

    In Situ Assay
    Products:
       

     
    Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for BPNT1

    Gene Ontology (GO): 4 molecular function terms (GO ID links to tree view):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0000287magnesium ion binding IEA--
    GO:0004437inositol or phosphatidylinositol phosphatase activity ----
    GO:0004441inositol-1,4-bisphosphate 1-phosphatase activity IEA--
    GO:00084413'(2'),5'-bisphosphate nucleotidase activity IEA--


    BPNT1 for ontologies           About GeneDecksing


    1 GenomeRNAi human phenotype for BPNT1:
     Decreased focal adhesion (FA)  

    Animal Models:
         Mouse knock-out Bpnt1tm1Yrk for BPNT1
         1 MGI mutant phenotype (inferred from 2 alleles(MGI details for Bpnt1):
     no phenotypic analysis 

    BPNT1 for phenotypes           About GeneDecksing


    (Pathways according to EMD Millipore, R&D Systems, Cell Signaling Technology, KEGG, PharmGKB, BioSystems, Reactome, Tocris Bioscience, GeneGo (Thomson Reuters), QIAGEN, and/or UniProtKB, Sets of similar genes according to GeneDecks, Interaction Networks according to SABiosciences, and/or STRING, Interactions according to 1UniProtKB, 2MINT, 3I2D, and/or 4STRING, with links to IntAct and Ensembl, Ontologies according to Gene Ontology Consortium 01 Mar 2013 via Entrez Gene).
    About This Section

    Unified GeneCards pathways  About this table 
    See pathways by source

    Super-pathwaycontained gene-specific pathways
    1Cytosolic sulfonation of small molecules
    Cytosolic sulfonation of small molecules1.00
    Sulfur metabolism0.44
    2Metabolism
    Metabolism1.00
    Metabolic pathways0.38
    3Biological oxidations
    Biological oxidations1.00
    Phase II conjugation0.52

    Pathway sources
    See GeneCards unified pathways
    Show all pathways


    4        Reactome Pathways for BPNT1
        Metabolism
    Biological oxidations
    Cytosolic sulfonation of small molecules
    Phase II conjugation


    2         Kegg Pathways  (Kegg details for BPNT1):
        Sulfur metabolism
    Metabolic pathways


    BPNT1 for pathways           About GeneDecksing

    Interactions:

        Search SABiosciences Gene Network CentralTM Interacting Genes and Proteins Networks for BPNT1

    STRING Interaction Network Preview (showing 5 interactants - click image to see 14)

    5/18 Interacting proteins for BPNT1 (O958613 ENSP000003188524) via UniProtKB, MINT, STRING, and/or I2D (see all 18)
    InteractantInteraction Details
    GeneCardExternal ID(s)
    DDA1Q9BW613I2D: score=1 
    IKBKEQ141643I2D: score=1 
    TRAF6Q9Y4K33I2D: score=1 
    UBA5Q9GZZ93I2D: score=1 
    CHST11ENSP000003057254STRING: ENSP00000305725
    About this table

    Gene Ontology (GO): 5/6 biological process terms (GO ID links to tree view) (see all 6):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0006139nucleobase-containing compound metabolic process TAS10224133
    GO:0006805xenobiotic metabolic process TAS--
    GO:0007399nervous system development TAS10224133
    GO:0044281small molecule metabolic process TAS--
    GO:0046854phosphatidylinositol phosphorylation IEA--


    BPNT1 for ontologies           About GeneDecksing



    (Chemical Compounds according to UniProtKB, Enzo Life Sciences, EMD Millipore, Tocris Bioscience HMDB, BitterDB, and/or Novoseek, and Drugs according to DrugBank, Enzo Life Sciences, and/or PharmGKB, with drugs/clinical trials/news search links to CenterWatch)
    About This Section
    Browse Small Molecules at EMD Millipore
    Browse drugs & compounds from Enzo Life Sciences

    Browse Tocris compounds for BPNT1

    9 HMDB Compounds for BPNT1    About this table
    CompoundSynonyms CAS #PubMed Ids
    Adenosine 3',5'-diphosphate3,5-Diphosphoadenosine (see all 10)1053-73-2--
    Adenosine monophosphate5'-AMP (see all 28)61-19-8--
    Adenosine phosphosulfateAdenosine Phosphosulfate (see all 13)485-84-7--
    LithiumLi (see all 5)7439-93-2--
    MagnesiumMagnesium (see all 2)7439-95-4--
    PhosphateNFB Orthophosphate (see all 13)14265-44-2--
    Phosphoadenosine phosphosulfate3'-Phospho-5'-adenylyl sulfate (see all 9)482-67-7--
    WaterDihydrogen oxide (see all 2)7732-18-5--
    ZolpidemAmbien (see all 7)82626-48-0--
    Search CenterWatch for drugs/clinical trials and news about BPNT1 

    (Secondary structures according to fRNAdb,
    GenBank/EMBL/DDBJ Accessions according to
    Unigene (Build 235 Homo sapiens; Mar 10 2013) or GenBank,
    RefSeq according to Entrez Gene,
    DOTS (version 10), and/or AceView, transcript ids from Ensembl with links to UCSC,
    exon structure from GeneLoc, alternative splicing isoforms according to ASD and/or ECgene,
    RNAi Products from EMD Millipore,
    siRNAs from OriGene, QIAGEN, shRNA from OriGene, microRNA from QIAGEN,
    Tagged/untagged cDNA clones from OriGene, SwitchGear Genomics, GenScript, DNA2.0, Vector BioLabs, Primers from OriGene, SABiosciences, and/or QIAGEN )
    About This Section

    REFSEQ mRNAs for BPNT1 gene: 
    NM_006085.4  

    Unigene Cluster for BPNT1:

    3'(2'), 5'-bisphosphate nucleotidase 1
    Hs.406134  [show with all ESTs]
    Unigene Representative Sequence: NM_006085
    11 Ensembl transcripts including schematic representations, and UCSC links where relevant:
    ENST00000469520 ENST00000354807 ENST00000482136 ENST00000463953 ENST00000498791
    ENST00000480959 ENST00000548668 ENST00000498237 ENST00000322067(uc001hma.3 uc010pug.2 uc010puh.2)
    ENST00000414869 ENST00000544404

    miRNA
    Products:
         
    OriGene 3'-UTR Clone: BPNT1
    Browse OriGene MicroRNA Expression Plasmids
    QIAGEN Custom miScript Target Protector blocks miRNA-binding site of human, mouse, rat BPNT1
    5 QIAGEN miScript miRNA Assays for microRNAs that regulate BPNT1:
    hsa-miR-607 hsa-miR-206 hsa-miR-613 hsa-miR-1 hsa-miR-1305
    SwitchGear 3'UTR luciferase reporter plasmidBPNT1 3' UTR sequence
    Inhib. RNA
    Products:
         
    Browse for Gene Knock-down Tools from EMD Millipore
    OriGene 29mer shRNA kits in GFP-retroviral vector in human, mouse, rat for BPNT1 (see all 7)
    OriGene shRNA RFP: BPNT1
    OriGene siRNA: BPNT1
    QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat BPNT1
    Clone
    Products:
         
    OriGene Myc/DDK tagged cDNA clones in CMV expression vector in human, mouse, rat for BPNT1 (see all 3)
    OriGene untagged cDNA clones in CMV expression vector in human, mouse, rat for BPNT1 (see all 3)
    OriGene custom cloning services – gene synthesis, subcloning, mutagenesis, variant library, vector shuttling 
    GenScript: all cDNA clones in your preferred vector: BPNT1 (NM_006085)
    DNA2.0 Custom Codon Optimized Gene Synthesis Service for BPNT1
    Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat BPNT1 
    Primer
    Products:
        
    OriGene genome-wide validated SYBR primer pairs in human, mouse, rat for BPNT1
    Browse OriGene validated miRNA SYBR primer pairs
    SABiosciences RT2 qPCR Primer Assay in human, mouse, rat BPNT1
      QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat BPNT1
      QIAGEN QuantiFast Probe-based Assays in human, mouse, rat BPNT1

    Additional cDNA sequence: 

    AJ249339.1 AK021941.1 AK291943.1 AK298476.1 AK300777.1 AK315962.1 BC017801.1 

    11 DOTS entries:

    DT.100026759  DT.40288530  DT.309993  DT.97843381  DT.100787582  DT.102823315  DT.91729031  DT.100026758 
    DT.121443346  DT.91729044  DT.100026757 

    24/106 AceView cDNA sequences (see all 106):

    BP345650 BP343778 AL600860 CR599062 AA206984 CA488991 CB110606 CB137379 
    AL528197 BP374906 BP373057 BC017801 BQ061741 NM_006085 AW074753 BU845985 
    CA422020 BI834802 BM855478 BI666522 BP343423 CB128808 BG257085 BI670168 

    GeneLoc Exon Structure

    4 Alternative Splicing Database (ASD) splice patterns (SP) for BPNT1    About this scheme

    ExUns: 1a · 1b · 1c · 1d ^ 2 ^ 3 ^ 4 ^ 5 ^ 6 ^ 7 ^ 8 ^ 9a · 9b ^ 10
    SP1:                    -                                   -                           
    SP2:                    -                                                               
    SP3:                                                        -                           
    SP4:                    -     -                             -                           


    ECgene alternative splicing isoforms for BPNT1

    (RNA expression data according to H-InvDB, NONCODE, miRBase, and RNAdb, Expression images according to data from BioGPS, Illumina Human BodyMap, and CGAP SAGE, Sets of similar genes according to GeneDecks, in vivo and in vitro expression data from LifeMap Discovery™, plus additional links to Genevestigator, and/or SOURCE, and/or BioGPS, and/or UniProtKB,
    PCR Arrays from SABiosciences, Primers from OriGene, SABiosciences, and/or QIAGEN, In Situ Hybridization Assays from Advanced Cell Diagnostics)
    About This Section

    BPNT1 expression in normal human tissues (normalized intensities)
    See probesets specificity/sensitivity at GeneAnnot
    About this imageBioGPS
    CGAP TAG: GGAATGTTCT

    Microarray
    RNAseq (Illumina Body Map)
    (100×FPKM)½
    SAGE (Serial Analysis of Gene Expression)

    About this image
    See BPNT1 Protein Expression from SPIRE MOPED and PaxDB
    Genevestigator expression for BPNT1

    SOURCE GeneReport for Unigene cluster: Hs.406134

    UniProtKB/Swiss-Prot: BPNT1_HUMAN, O95861
    Tissue specificity: Highly expressed in kidney, liver, pancreas and heart. Detected at lower levels in brain, placenta,
    lung and skeletal muscle

        SABiosciences Custom PCR Arrays for BPNT1
    Primer
    Products:
    OriGene genome-wide validated SYBR primer pairs in human, mouse, rat for BPNT1
    Browse OriGene validated miRNA SYBR primer pairs
    SABiosciences RT2 qPCR Primer Assay in human, mouse, rat BPNT1
    QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat BPNT1
    QIAGEN QuantiFast Probe-based Assays in human, mouse, rat BPNT1
    In Situ
    Assay Products:
     

     
    Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for BPNT1

    (Orthologs according to 1,2HomoloGene (2older version, for species not in 1newer version), 3euGenes, 4SGD , 5MGI Mar 06 2013, with possible further links to Flybase and/or WormBase, and/or 6Ensembl pan taxonomic compara , Gene Trees according to Ensembl and TreeFam)
    About This Section

    This gene was present in the common ancestor of animals.

    Orthologs for BPNT1 gene from 6/24 species (see all 24)    About this table
    Organism Taxonomic
    classification
    Gene Description Human
    Similarity
    Orthology
    Type
    Details
    chicken
    (Gallus gallus)
    Aves BPNT11 3'(2'), 5'-bisphosphate nucleotidase 1 77.02(n)
    80.72(a)
      421347  NM_001012874.2  NP_001012892.2 
    lizard
    (Anolis carolinensis)
    Reptilia BPNT16
    --
    84(a)
    1 ↔ 1
    1(243261135-243271725)
    tropical clawed frog
    (Xenopus tropicalis)
    Amphibia Str.38092 Transcribed sequence with moderate similarity to protein more 77.49(n)    AL879086.2 
    zebrafish
    (Danio rerio)
    Actinopterygii Dr.153862 Transcribed sequence with weak similarity to protein more 75.3(n)    AL918203.1 
    fruit fly
    (Drosophila melanogaster)
    Insecta CG77891 , 3 3'(2'),5'-bisphosphate nucleotidase3
    CG77891
    50(a)3
    52.98(n)1
    51.66(a)1
      99C13
    435161  NM_143471.21  NP_651728.11 
    worm
    (Caenorhabditis elegans)
    Secernentea ZK430.23
    tag-2311
    ammonium transport protein3
    Protein TAG-2311
    42(a)3
    54.83(n)1
    47.59(a)1
      II(4420303-4422207)3
    1737771  NM_062379.41  NP_494780.11 


    ENSEMBL Gene Tree for BPNT1 (if available)
    TreeFam Gene Tree for BPNT1 (if available) 

    (Paralogs according to 1HomoloGene,
    2Ensembl, and 3SIMAP, Pseudogenes according to 4Pseudogene.org Build 68)
    About This Section
    Paralogs for BPNT1 gene
    IMPAD12  
    1 SIMAP similar gene for BPNT1 using alignment to 8 protein entries:     BPNT1_HUMAN (see all proteins):
    IMPAD1

    BPNT1 for paralogs           About GeneDecksing



    (SNPs/Variants according to the 1NCBI SNP Database, 2Ensembl, 3PupaSUITE, UniProtKB, and DNA2.0, Linkage Disequilibrium by HapMap, Structural Variations(CNVs/InDels/Inversions) from the Database of Genomic Variants, Mutations from the Human Gene Mutation Database (HGMD) and the Locus Specific Mutation Databases (LSDB), Blood group antigen gene mutations by BGMUT, Resequencing Primers from QIAGEN, Cancer Mutation PCR Arrays and Assays and Copy Number PCR Arrays from SABiosciences)
    About This Section

    10/507 NCBI SNPs in BPNT1 are shown (see all 507    About this table
    Genomic DataTranscription Related DataAllele Frequencies
    SNP IDValidClinical
    significance
    Chr 1 posSequence#AA
    Chg
    TypeMore#Allele
    freq
    PopTotal
    sample
    More
    ----------
    rs1137559561,2
    C,--220230377(+) AATAA-/ACACAC
            
    ACACA
    1 -- ds50011Minor allele frequency- ACACAC:0.50CSA 2
    rs1511342981,2
    --220230377(+) AATAA-/ACA   
       CACAC
    ACACA
    1 -- ds50010--------
    rs1151905751,2
    F,--220230423(+) AAATCG/ATTGGG 1 -- ds50011Minor allele frequency- A:0.03WA 118
    rs1816517911,2
    --220230528(+) ACCTCA/TGCCTC 1 -- ds50010--------
    rs1493455041,2
    --220230603(+) TGCCCA/GGCTAA 1 -- ds50010--------
    rs1862337701,2
    --220230613(+) ATTTTC/TGTATT 1 -- ds50010--------
    rs1909510011,2
    --220230733(+) CACTGC/TGCCTG 1 -- ds50010--------
    rs1823406731,2
    --220230768(+) AATCTC/TCCTAG 1 -- ds50010--------
    rs118039601,2
    C,F,H,--220230785(+) CTGATA/GTGCAG 1 -- ds50017Minor allele frequency- G:0.07NS EA NA CSA WA 538
    rs1414297861,2
    --220230791(+) TGCAGC/TTGAGT 1 -- ds50010--------

    HapMap Linkage Disequilibrium report for BPNT1 (220230824 - 220263804 bp)
    Structural Variations (Copy Number Variations, Insertions/Deletions, Inversions)
          Database of Genomic Variants (DGV) variations for BPNT1: --

    SABiosciences Cancer Mutation PCR Assays
    QIAGEN SeqTarget long-range PCR primers in human, mouse, rat for resequencing BPNT1
    DNA2.0 Custom Variant and Variant Library Synthesis for BPNT1

    (in which this Gene is Involved, According to MalaCards, OMIM, UniProtKB, the University of Copenhagen DISEASES database, Genatlas, GeneTests, GAD, HuGE Navigator, and/or TGDB.)
    About This Section

    BPNT1 for disorders           About GeneDecksing

    OMIM gene information: 604053    OMIM disorders: --

    3 diseases for BPNT1:    About MalaCards
    neonatal jaundice    jaundice    ovarian cancer

    1 disease from the University of Copenhagen DISEASES database for BPNT1:
    Neonatal jaundice
    Human Genome Epidemiology (HuGE) Navigator: BPNT1 (1 document)

    Export disorders for BPNT1 gene to outside databases

    (in PubMed. Associations of this gene to articles via 1Entrez Gene, 2UniProtKB/Swiss-Prot, 3HGNC, 4GAD, 5PharmGKB, 6HMDB, 7DrugBank, 8UniProtKB/TrEMBL, 9 Novoseek, and/or 10fRNAdb)
    About This Section

    PubMed articles for BPNT1 gene integrated from 9 sources:
    (articles sorted by number of sources associating them with BPNT1)
        Utopia: connect your pdf to the dynamic
    world of online information

    1. Cloning and characterization of a mammalian lithium-sensitive bisphosphate 3'-nucleotidase inhibited by inositol 1,4-bisphosphate. (PubMed id 10224133)1, 2, 3, 9 Spiegelberg B.D.... York J.D. (1999)
    2. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PubMed id 15489334)1, 2 Gerhard D.S....Malek J. (2004)
    3. Complete sequencing and characterization of 21,243 full-length human cDNAs. (PubMed id 14702039)1, 2 Ota T.... Sugano S. (2004)
    4. Methods for quantification of in vivo changes in prote in ubiquitination following proteasome and deubiquitinase inhibition. (PubMed id 22505724)1 Udeshi N.D....Carr S.A. (2012)
    5. Initial characterization of the human central proteome. (PubMed id 21269460)2 Burkard T.R.... Colinge J. (2011)
    6. Mass spectrometric analysis of lysine ubiquitylation r eveals promiscuity at site level. (PubMed id 21139048)1 Danielsen J.M....Nielsen M.L. (2011)
    7. Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility 'hot-spot'. (PubMed id 20628624)1 Johnatty S.E.... . (2010)
    8. Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. (PubMed id 12477932)1 Strausberg R.L....Marra M.A. (2002)
    9. Complementation of an E. coli cysteine auxotrophic mutant for the structural modification study of 3'(2'),5'-bisphosphate nucleotidase. (PubMed id 17450323)9 Cheong J.J....Kwon H.B. (2007)
    10. Alteration of lithium pharmacology through manipulation of phosphoadenosine phosphate metabolism. (PubMed id 15583009)9 Spiegelberg B.D....York J.D. (2005)

    (in PubMed, OMIM, and NCBI Bookshelf)
    About This Section
     ANDOR
    Aliases
    Free Text  

      Query String
    PubMed
    OMIM
    NCBI Bookshelf
      (Note: In FireFox, select the above section and copy using Ctrl-C)

    (According to Entrez Gene, HGNC, AceView, euGenes, Ensembl, miRBase, ECgene, Kegg, and/or H-InvDB)
    About This Section
    Entrez Gene: 10380 HGNC: 1096 AceView: BPNT1 Ensembl:ENSG00000162813 euGenes: HUgn10380
    ECgene: BPNT1 Kegg: 10380 H-InvDB: BPNT1

    (According to HUGE)
    About This Section
      --

    (According to PharmGKB, ATLAS, HORDE, IMGT, LEIDEN, UniProtKB/Swiss-Prot, and/or UniProtKB/TrEMBL,
    Wikipedia and/or GeneReviews via UniProtKB/Swiss-Prot)
    About This Section
    NameDescription
    PharmGKB entry for BPNT1 Pharmacogenomics, SNPs, Pathways

    (Patent information from GeneIP,
    Licensable technologies from WIS Yeda, Salk, Tufts,
    IP news from LifeMap Sciences, Inc.)
    About This Section
    Patent Information for BPNT1 gene:
    Search GeneIP for patents involving BPNT1

    GeneCards and IP:
    Japan Patent Office Licenses GeneCards     European Patent Office Licenses GeneCards     Improving the IP Search



    (Antibodies, recombinant proteins, and assays from EMD Millipore, R&D Systems, OriGene, QIAGEN, GenScript, Cell Signaling Technology, SABiosciences, Novus Biologicals, Sino Biological, Enzo Life Sciences, Abcam, ProSpec, Uscn, Thermo Fisher Scientific, Gene Editing from DNA2.0, Clones from EMD Millipore, OriGene, GenScript, Sino Biological, DNA2.0, SwitchGear Genomics, Vector BioLabs, Cell lines from GenScript and LifeMap BioReagents, PCR Arrays from SABiosciences, Drugs and/or compounds from EMD Millipore, Tocris Bioscience, and/or Enzo Life Sciences),
    In Situ Hybridization Assays from
    Advanced Cell Diagnostics
    About This Section

     
     EMD Millipore Custom Antibody & Bulk Services
     EMD Millipore Preclinical / Clinical Development Services
     EMD Millipore Immunoassay Services
     EMD Millipore Target Screening & Profiling Services

      
     Browse Antibodies   Browse Cell Culture Products  
     Browse ELISAs   Browse Flow Cytometry Kits  
     Browse Primer Pairs   Browse Kinase Activity Assays/Reagents  
     Browse ELISpot Kits/Development Modules   Browse TFB/Immunoprecipitation Assays  
     Browse Apoptosis Detection Kits/Reagents   Browse Ubiquitin Proteasome Pathway (UPP) Assay Kits/Reagents  
     Browse DNA Damage/Repair Kits/Reagents   Browse Multiplex/Array Assay Kits/Reagents  
     Browse Cell Selection/Detection Kits/Reagents   Browse Secondary Antibodies/Controls/Staining Reagents  
     Browse Phosphatase Activity Assays/Reagents   Browse Recombinant/Natural Proteins  
     OriGene Antibodies for BPNT1   OriGene shRNA RFP for BPNT1  
     OriGene 29mer shRNA kits in GFP-retroviral vector in human, mouse, rat for BPNT1   OriGene genome-wide validated SYBR primer pairs in human, mouse, rat for BPNT1  
     OriGene Protein Over-expression Lysate for BPNT1   Browse OriGene Fluorogenic Cell Assay Kits  
     OriGene siRNA for BPNT1   OriGene 3'-UTR Clone for BPNT1  
     OriGene untagged cDNA clones in CMV expression vector in human, mouse, rat for BPNT1   OriGene Myc/DDK tagged cDNA clones in CMV expression vector in human, mouse, rat for BPNT1  
     Browse OriGene GFP tagged cDNA clones in CMV expression vector   Browse OriGene MicroRNA Expression Plasmids  
     Browse OriGene basic RS shRNAs   Browse OriGene validated miRNA SYBR primer pairs  
     OriGene Purified Protein for BPNT1   OriGene custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling  
     OriGene Custom Antibody Services for BPNT1   OriGene Custom Protein Services for BPNT1  
     OriGene Custom Immunoassay Development  

     
     
     QIAGEN Custom miScript Target Protector blocks miRNA-binding site of in human, mouse, rat BPNT1
     QIAGEN SeqTarget long-range PCR primers in human, mouse, rat for resequencing BPNT1
     QIAGEN PyroMark CpG Assay predesigned Pyrosequencing DNA Methylation assays in human, mouse, rat BPNT1
     QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat BPNT1
     QIAGEN QuantiFast Probe-based Assays in human, mouse, rat BPNT1
     QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat BPNT1
     GenScript Custom Purified and Recombinant Proteins Services for BPNT1 GenScript cDNA clones with any tag delivered in your preferred vector for BPNT1
     GenScript Custom Assay Services for BPNT1 GenScript Custom Superior Antibodies Services for BPNT1
     GenScript Custom overexpressing Cell Line Services for BPNT1 CloneReady with Over 120,000 Genes
     Gene Synthesis: Any Gene in Any Vector Vector-based siRNA and miRNA, Ready for Transfection
     Gene Mutant Library, Variants up to 10^11 Plasmid Preparation
     Custom Peptide Services
     Search for Antibodies & Assays

     Regulatory tfbs in BPNT1 promoter
     Search Chromatin IP Primers for BPNT1
     RT2 qPCR Primer Assay in human, mouse, rat BPNT1
     Search GNC Networks for BPNT1
     SABiosciences Custom PCR Arrays for BPNT1
     Search Tocris compounds for BPNT1
     Browse Sino Biological Proteins and Antibodies
     Browse Sino Biological cDNA Clones
     Antibodies/Proteins Production Services
     Rabbit Monoclonal Antibody Platform
     Bulk Purchasing
     Search www.enzolifesciences.com for proteins, assays, substrates, inhibitors & antibodies
     Novus Tissue Slides
     BPNT1 antibodies
     BPNT1 proteins
     BPNT1 lysates
     Search for Antibodies for BPNT1 at Abcam
     See all of Abcam's Antibodies, Kits and Proteins for BPNT1
     Custom Antibody / Protein Production Service
     Bulk Purchasing
     Advantages of Rabbit Monoclonal antibodies
     Abcam protocols and scientific support
     Recombinant Protein for BPNT1




     BPNT1 Proteins, Antibodies, CLIAs, and ELISAs
     Search LifeMap BioReagents cell lines for BPNT1
     Gene Synthesis
     Protein Engineering
     Variant Library Synthesis
     Codon Optimization
     Protein Production and Purification
     Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for BPNT1
     SwitchGear 3'UTR luciferase reporter plasmids for BPNT1
     SwitchGear Promoter luciferase reporter plasmids for BPNT1
     ThermoFisher Antibodies for BPNT1
     Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat BPNT1
           
    GeneCards Homepage - Last full update: 18 Mar 2013 - Incrementals: 21 Mar 2013 , 15 Apr 2013 , 27 Apr 2013

    View Random Gene

    Category
    VWF
    (GIFTS: 73)
    von Willebrand factor
    GIFtS Group
    The GeneCards human gene database gene index: 1 3 5 6 A B C D E F G H I J K L M N O P Q R S T U V W X Y Z 


    Developed at the Crown Human Genome Center, Department of Molecular Genetics, the Weizmann Institute of Science

    Hot genes      Disease genes      BPNT1 gene at Home site.
    hostname: 356977-web1.xennexinc.com index build: 100 solr: 1.4