Aliases for ALDH2 Gene
Aliases for ALDH2 Gene
External Ids for ALDH2 Gene
- HGNC: 404
- Entrez Gene: 217
- Ensembl: ENSG00000111275
- OMIM: 100650
- UniProtKB: P05091
Previous GeneCards Identifiers for ALDH2 Gene
- GC12P111101
- GC12P111726
- GC12P111987
- GC12P110616
- GC12P110667
- GC12P112205
- GC12P109217
Summaries for ALDH2 Gene
-
This protein belongs to the aldehyde dehydrogenase family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. Two major liver isoforms of aldehyde dehydrogenase, cytosolic and mitochondrial, can be distinguished by their electrophoretic mobilities, kinetic properties, and subcellular localizations. Most Caucasians have two major isozymes, while approximately 50% of East Asians have the cytosolic isozyme but not the mitochondrial isozyme. A remarkably higher frequency of acute alcohol intoxication among East Asians than among Caucasians could be related to the absence of a catalytically active form of the mitochondrial isozyme. The increased exposure to acetaldehyde in individuals with the catalytically inactive form may also confer greater susceptibility to many types of cancer. This gene encodes a mitochondrial isoform, which has a low Km for acetaldehydes, and is localized in mitochondrial matrix. Alternative splicing results in multiple transcript variants encoding distinct isoforms.[provided by RefSeq, Nov 2016]
GeneCards Summary for ALDH2 Gene
ALDH2 (Aldehyde Dehydrogenase 2 Family (Mitochondrial)) is a Protein Coding gene. Diseases associated with ALDH2 include Alcohol Sensitivity, Acute and Alcohol Use Disorder. Among its related pathways are superpathway of tryptophan utilization and Neurotransmitter Clearance In The Synaptic Cleft. Gene Ontology (GO) annotations related to this gene include oxidoreductase activity and aldehyde dehydrogenase (NAD) activity. An important paralog of this gene is ALDH1B1.
-
Aldehyde dehydrogenase enzymes oxidize aldehydes to generate carboxylic acids for use in the muscle and heart. Numerous aldehyde dehydrogenase genes exist, of which ALDH2 is best known for its role in alcohol oxidation.
Additional gene information for ALDH2 Gene
- Monarch Initiative
- Search for ALDH2 at DataMed
- Search for ALDH2 at HumanCyc
No data available for CIViC summary , UniProtKB/Swiss-Prot , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for ALDH2 Gene
Genomics for ALDH2 Gene
GeneHancer (GH) Regulatory Elements for ALDH2 Gene
- Top Transcription factor binding sites by QIAGEN in the ALDH2 gene promoter:
Regulatory Element Products
Genomic Locations for ALDH2 Gene
- chr12:111,766,887-111,817,529
- (GRCh38/hg38)
- Size:
- 50,643 bases
- Orientation:
- Plus strand
- chr12:112,204,691-112,247,789
- (GRCh37/hg19)
Genomic View for ALDH2 Gene
- Cytogenetic band:
-
- 12q24.12 by Ensembl
- 12q24.12 by Entrez Gene
- 12q24.12 by HGNC


RefSeq DNA sequence for ALDH2 Gene
Proteins for ALDH2 Gene
-
Protein details for ALDH2 Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- P05091-ALDH2_HUMAN
- Recommended name:
- Aldehyde dehydrogenase, mitochondrial
- Protein Accession:
- P05091
- B4DW54
- E7EUE5
- Q03639
- Q6IB13
- Q6IV71
Protein attributes for ALDH2 Gene
- Size:
- 517 amino acids
- Molecular mass:
- 56381 Da
- Quaternary structure:
-
- Homotetramer.
- SequenceCaution:
-
- Sequence=AAA62825.1; Type=Frameshift; Positions=424, 444, 448, 461; Evidence={ECO:0000305}; Sequence=CAA68290.1; Type=Frameshift; Positions=Several; Evidence={ECO:0000305}; Sequence=CAA68290.1; Type=Miscellaneous discrepancy; Evidence={ECO:0000305};
Three dimensional structures from OCA and Proteopedia for ALDH2 Gene
Protein Expression for ALDH2 Gene
Selected DME Specific Peptides for ALDH2 Gene
- P05091:
-
- QIIPWNFP
- EFVERSVARA
- GPTAGAAI
- FTKDLDKA
- WKLGPAL
- DVDKVAFTGSTE
- GPQVDETQ
- VTLELGG
- LADLIERD
- EAGFPPGV
- SDADMDWAVEQAHFALFFNQGQCC
- YGLAAAVFTKDLDKANYLSQALQAGTVW
- DVDKAVKAA
- PWNFPLLM
- EGAKLLCGG
- AYTEVKTVT
- RGRLLNRLADL
- ALQAGTVW
- GAAIASH
- YGLAAAVFT
- TLELGGK
- PFGGYKMSG
- AGSRTFV
- KTFPTVNP
- RYYAGWADK
- PTVFGDVQDGM
- ISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGD
- QALQAGTVWVN
- LGSPWRRMDAS
- FFNQGQCC
- VVMKVAEQTPL
- AQSPFGG
- YTEVKTVT
- GVVNIVPG
- NCYDVFGAQSPFGGYK
- GDKEDVD
Post-translational modifications for ALDH2 Gene
Other Protein References for ALDH2 Gene
- ENSEMBL proteins:
- REFSEQ proteins:
Antibody Products
- Novus Biologicals Antibodies for ALDH2
-
Abcam antibodies for ALDH2
-
Cloud-Clone Corp. Antibodies for ALDH2
- Invitrogen Antibodies for ALDH2
- GeneTex ALDH2 antibody for ALDH2
-
Santa Cruz Biotechnology (SCBT) Antibodies for ALDH2
Protein Products
-
OriGene Purified Proteins for ALDH2
- Search Origene for MassSpec and Protein Over-expression Lysates for ALDH2
- Origene Custom Protein Services for ALDH2
- ProSpec Recombinant Proteins for ALDH2
-
Cloud-Clone Corp. Proteins for ALDH2
- Search GeneTex for Proteins for ALDH2
-
Abcam proteins for ALDH2
Assay Products
-
Cloud-Clone Corp. Assay Kits for ALDH2
Domains & Families for ALDH2 Gene
Gene Families for ALDH2 Gene
- HGNC:
- Human Protein Atlas (HPA):
-
- Cancer-related genes
- Enzymes
- FDA approved drug targets
- Plasma proteins
- Predicted intracellular proteins
Protein Domains for ALDH2 Gene
- InterPro:
- Blocks:
- ProtoNet:
Suggested Antigen Peptide Sequences for ALDH2 Gene
- GenScript: Design optimal peptide antigens:
Graphical View of Domain Structure for InterPro Entry
P05091- Family:
-
- Belongs to the aldehyde dehydrogenase family.
Function for ALDH2 Gene
Molecular function for ALDH2 Gene
- GENATLAS Biochemistry:
- aldehyde dehydrogenase 2,mitochondrial,E2 isoform
- UniProtKB/Swiss-Prot CatalyticActivity:
- An aldehyde + NAD(+) + H(2)O = a carboxylate + NADH.
Enzyme Numbers (IUBMB) for ALDH2 Gene
Phenotypes From GWAS Catalog for ALDH2 Gene
GO ID | Qualified GO term | Evidence | PubMed IDs |
---|---|---|---|
GO:0004029 | aldehyde dehydrogenase (NAD) activity | IDA | 4015840 |
GO:0004030 | aldehyde dehydrogenase [NAD(P)+] activity | TAS | 8903321 |
GO:0009055 | electron transfer activity | TAS | 8903321 |
GO:0016491 | oxidoreductase activity | IEA | -- |
GO:0051287 | NAD binding | ISS | 12693930 |
Phenotypes for ALDH2 Gene
- MGI mutant phenotypes for ALDH2:
-
inferred from 5 alleles
- nervous system phenotype
- homeostasis/metabolism phenotype
- mortality/aging
- immune system phenotype
- cellular phenotype
- behavior/neurological phenotype
- growth/size/body region phenotype
- neoplasm
- endocrine/exocrine gland phenotype
- reproductive system phenotype
- vision/eye phenotype
- integument phenotype
- hematopoietic system phenotype
- skeleton phenotype
- pigmentation phenotype
- renal/urinary system phenotype
- liver/biliary system phenotype
- limbs/digits/tail phenotype
- GenomeRNAi human phenotypes for ALDH2:
-
- Increased viability
- Increased vaccinia virus (VACV) infection
- Negative genetic interaction between MUS81-/- and MUS81+/+
- shRNA abundance <= 50%
- Mildly decreased CFP-tsO45G cell surface transport
- Decreased viability in esophageal squamous lineage
- Decreased viability ratio
- Decreased shRNA abundance (Z-score < -2)
- Increased shRNA abundance (Z-score > 2)
Animal Model Products
- Taconic Biosciences: Generate A Custom CRISPR Mouse Model For Your Study
-
ViGene Biosciences lentiviral particle packaged cDNA for ALDH2 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for ALDH2 gene
- Search ViGene Biosciences for ALDH2
CRISPR Products
-
OriGene CRISPR knockouts for ALDH2
- genomics-online: gRNA clones - Search results for available ALDH2 gene related products
- Applied Biological Materials CRISPR for ALDH2
-
Vectors and viruses for KO, Activation, Repression, and more
-
Santa Cruz Biotechnology (SCBT) CRISPR for ALDH2
- GenScript: Design CRISPR guide RNA sequences for ALDH2
miRNA for ALDH2 Gene
- miRTarBase miRNAs that target ALDH2
miRNA Products
- Search ViGene Biosciences for ALDH2
Inhibitory RNA Products
- Origene RNAi, shrna, and sirna products in human, mouse, rat for ALDH2
- Browse OriGene Inhibitory RNA Products For ALDH2
- genomics-online: shRNA clones - Search results for available ALDH2 gene related products
-
ViGene Biosciences ready-to-package AAV shRNAs for ALDH2 gene
Clone Products
- Sino Biological Human cDNA Clone for ALDH2
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- genomics-online: cdna clones - Search results for available ALDH2 gene related products
- orf clones - Search results for available ALDH2 gene related products
- Applied Biological Materials Clones for ALDH2
-
Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more
Cell Line Products
-
Horizon Cell Lines for ALDH2
-
ViGene Biosciences adenoviral particle packaged cDNA for ALDH2 gene
-
ViGene Biosciences lentiviral particle packaged cDNA for ALDH2 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for ALDH2 gene
No data available for Transcription Factor Targets and HOMER Transcription for ALDH2 Gene
Localization for ALDH2 Gene
Subcellular locations from UniProtKB/Swiss-Prot for ALDH2 Gene
- Mitochondrion matrix.
GO ID | Qualified GO term | Evidence | PubMed IDs |
---|---|---|---|
GO:0005739 | mitochondrion | IEA | -- |
GO:0005759 | mitochondrial matrix | TAS | -- |
GO:0070062 | extracellular exosome | IDA,HDA | 19056867 |
No data available for Subcellular locations from the Human Protein Atlas (HPA) for ALDH2 Gene
Pathways & Interactions for ALDH2 Gene
SuperPathway | Contained pathways | ||
---|---|---|---|
1 | superpathway of tryptophan utilization | ||
2 | Cytochrome P450 - arranged by substrate type | ||
3 | Neurotransmitter Clearance In The Synaptic Cleft | ||
4 | ethanol degradation II | ||
5 | beta-Alanine metabolism (KEGG) |
Pathways by source for ALDH2 Gene
10 BioSystems pathways for ALDH2 Gene
9 Reactome pathways for ALDH2 Gene
2 PharmGKB pathways for ALDH2 Gene
12 KEGG pathways for ALDH2 Gene
1 GeneGo (Thomson Reuters) pathway for ALDH2 Gene
UniProtKB/Swiss-Prot P05091-ALDH2_HUMAN
- Pathway: Alcohol metabolism; ethanol degradation; acetate from ethanol: step 2/2.
Interacting Proteins for ALDH2 Gene
GO ID | Qualified GO term | Evidence | PubMed IDs |
---|---|---|---|
GO:0005975 | carbohydrate metabolic process | TAS | 8903321 |
GO:0006066 | alcohol metabolic process | TAS | 1306115 |
GO:0006068 | ethanol catabolic process | IEA | -- |
GO:0006069 | ethanol oxidation | TAS | -- |
GO:0008152 | metabolic process | IEA | -- |
No data available for SIGNOR curated interactions for ALDH2 Gene
Drugs & Compounds for ALDH2 Gene
(52) Drugs for ALDH2 Gene - From: DrugBank, PharmGKB, ClinicalTrials, ApexBio, DGIdb, HMDB, Tocris, and Novoseek
Name | Status | Disease Links | Group | Role | Mechanism of Action | Clinical Trials |
---|---|---|---|---|---|---|
Disulfiram | Approved | Pharma | Target, inhibitor | Reversibly stimulates SERCA Ca2+-ATPase; displays a range of other activities | 41 | |
Nitroglycerin | Approved, Investigational | Pharma | Enzyme, substrate | 179 | ||
NADH | Approved | Nutra | Target | 0 | ||
Amyl Nitrite | Approved | Pharma | Enzyme, substrate | 1 | ||
Guanidine | Approved | Pharma | Target | 0 |
Name | Synonyms | Role | CAS Number | PubChem IDs | PubMed IDs | |
---|---|---|---|---|---|---|
(E)-2-Butenal |
|
123-73-9 | ||||
(S)-Methylmalonic acid semialdehyde |
|
99043-16-0 |
|
|||
2,5-Dioxopentanoate |
|
|
||||
2-Methyl-3-oxopropanoic acid |
|
6236-08-4 |
|
|||
2-Propyn-1-al |
|
|
(4) Tocris Compounds for ALDH2 Gene
(3) ApexBio Compounds for ALDH2 Gene
Transcripts for ALDH2 Gene
mRNA/cDNA for ALDH2 Gene
- (2) REFSEQ mRNAs :
- (13) Additional mRNA sequences :
- (651) Selected AceView cDNA sequences:
- (5) Ensembl transcripts including schematic representations, and UCSC links where relevant :
Unigene Clusters for ALDH2 Gene
CRISPR Products
-
OriGene CRISPR knockouts for ALDH2
- genomics-online: gRNA clones - Search results for available ALDH2 gene related products
- Applied Biological Materials CRISPR for ALDH2
-
Vectors and viruses for KO, Activation, Repression, and more
-
Santa Cruz Biotechnology (SCBT) CRISPR for ALDH2
- GenScript: Design CRISPR guide RNA sequences for ALDH2
miRNA Products
- Search ViGene Biosciences for ALDH2
Inhibitory RNA Products
- Origene RNAi, shrna, and sirna products in human, mouse, rat for ALDH2
- Browse OriGene Inhibitory RNA Products For ALDH2
- genomics-online: shRNA clones - Search results for available ALDH2 gene related products
-
ViGene Biosciences ready-to-package AAV shRNAs for ALDH2 gene
Clone Products
- Sino Biological Human cDNA Clone for ALDH2
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- genomics-online: cdna clones - Search results for available ALDH2 gene related products
- orf clones - Search results for available ALDH2 gene related products
- Applied Biological Materials Clones for ALDH2
-
Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more
ExUns: | 1a | · | 1b | ^ | 2 | ^ | 3 | ^ | 4a | · | 4b | ^ | 5 | ^ | 6a | · | 6b | ^ | 7 | ^ | 8 | ^ | 9 | ^ | 10a | · | 10b | ^ | 11 | ^ | 12 | ^ | 13 | ^ | 14a | · | 14b | · | 14c |
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
SP1: | |||||||||||||||||||||||||||||||||||||||
SP2: | - | ||||||||||||||||||||||||||||||||||||||
SP3: | - | - | - | - | |||||||||||||||||||||||||||||||||||
SP4: | - |
Expression for ALDH2 Gene
mRNA differential expression in normal tissues according to GTEx for ALDH2 Gene
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for ALDH2 Gene
NURSA nuclear receptor signaling pathways regulating expression of ALDH2 Gene:
ALDH2SOURCE GeneReport for Unigene cluster for ALDH2 Gene:
Hs.604551Evidence on tissue expression from TISSUES for ALDH2 Gene
- Liver(4.9)
- Nervous system(4.9)
- Muscle(4.6)
- Lung(3.4)
- Heart(3.3)
- Intestine(3.2)
- Stomach(3.1)
- Blood(2.9)
- Kidney(2.9)
- Skin(2.8)
- Adrenal gland(2.4)
- Eye(2.2)
Phenotype-based relationships between genes and organs from Gene ORGANizer for ALDH2 Gene
- ectoderm
- mesoderm
- cardiovascular
- integumentary
- face
- head
- blood
- blood vessel
- skin
Primer Products
-
OriGene qPCR primer pairs for ALDH2
-
OriGene qPCR primer pairs and template standards for ALDH2
- genomics-online: primer clones - Search results for available ALDH2 gene related products
No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery and mRNA Expression by UniProt/SwissProt for ALDH2 Gene
Orthologs for ALDH2 Gene
This gene was present in the common ancestor of eukaryotes.
Organism | Taxonomy | Gene | Similarity | Type | Details |
---|---|---|---|---|---|
chimpanzee (Pan troglodytes) |
Mammalia | ALDH2 33 |
|
||
dog (Canis familiaris) |
Mammalia | -- 34 |
|
ManyToMany | |
ALDH2 33 |
|
||||
-- 34 |
|
ManyToMany | |||
oppossum (Monodelphis domestica) |
Mammalia | -- 34 |
|
OneToMany | |
cow (Bos Taurus) |
Mammalia | ALDH2 33 34 |
|
||
rat (Rattus norvegicus) |
Mammalia | Aldh2 33 |
|
||
platypus (Ornithorhynchus anatinus) |
Mammalia | -- 34 |
|
OneToMany | |
mouse (Mus musculus) |
Mammalia | Aldh2 33 16 34 |
|
||
chicken (Gallus gallus) |
Aves | -- 34 |
|
OneToMany | |
ALDH2 33 |
|
||||
lizard (Anolis carolinensis) |
Reptilia | -- 34 |
|
OneToMany | |
tropical clawed frog (Silurana tropicalis) |
Amphibia | aldh2 33 |
|
||
zebrafish (Danio rerio) |
Actinopterygii | aldh2.2 34 |
|
ManyToMany | |
aldh2.1 33 |
|
||||
fruit fly (Drosophila melanogaster) |
Insecta | Aldh 33 34 |
|
||
CG3752 35 |
|
|
|||
African malaria mosquito (Anopheles gambiae) |
Insecta | AgaP_AGAP003652 33 |
|
||
worm (Caenorhabditis elegans) |
Secernentea | alh-1 33 |
|
||
A. gosspyii yeast (Ashbya gossypii) |
Saccharomycetes | AGOS_ACL044W 33 |
|
||
K. lactis yeast (Kluyveromyces lactis) |
Saccharomycetes | KLLA0C07777g 33 |
|
||
baker's yeast (Saccharomyces cerevisiae) |
Saccharomycetes | ALD5 33 |
|
||
ALD6 36 |
|
|
|||
thale cress (Arabidopsis thaliana) |
eudicotyledons | ALDH2B4 33 |
|
||
bread mold (Neurospora crassa) |
Ascomycetes | NCU03415 33 |
|
||
fission yeast (Schizosaccharomyces pombe) |
Schizosaccharomycetes | SPAC9E9.09c 33 |
|
||
sea squirt (Ciona intestinalis) |
Ascidiacea | Cin.10427 33 |
|
- Species where no ortholog for ALDH2 was found in the sources mined by GeneCards:
-
- Actinobacteria (Mycobacterium tuberculosis)
- African clawed frog (Xenopus laevis)
- Alicante grape (Vitis vinifera)
- alpha proteobacteria (Wolbachia pipientis)
- amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- barley (Hordeum vulgare)
- beta proteobacteria (Neisseria meningitidis)
- Chromalveolata (Phytophthora infestans)
- common water flea (Daphnia pulex)
- corn (Zea mays)
- E. coli (Escherichia coli)
- filamentous fungi (Aspergillus nidulans)
- Firmicute bacteria (Streptococcus pneumoniae)
- green algae (Chlamydomonas reinhardtii)
- honey bee (Apis mellifera)
- loblloly pine (Pinus taeda)
- malaria parasite (Plasmodium falciparum)
- medicago trunc (Medicago Truncatula)
- moss (Physcomitrella patens)
- orangutan (Pongo pygmaeus)
- pig (Sus scrofa)
- rainbow trout (Oncorhynchus mykiss)
- rice (Oryza sativa)
- rice blast fungus (Magnaporthe grisea)
- schistosome parasite (Schistosoma mansoni)
- sea anemone (Nematostella vectensis)
- sea urchin (Strongylocentrotus purpuratus)
- sorghum (Sorghum bicolor)
- soybean (Glycine max)
- stem rust fungus (Puccinia graminis)
- sugarcane (Saccharum officinarum)
- tomato (Lycopersicon esculentum)
- toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- wheat (Triticum aestivum)
Paralogs for ALDH2 Gene
Paralogs for ALDH2 Gene
(13) SIMAP similar genes for ALDH2 Gene using alignment to 8 proteins:
Variants for ALDH2 Gene
Polymorphic Variants from UniProtKB/Swiss-Prot for ALDH2 Gene
- ALDH2_HUMAN-P05091
- Genetic variation in ALDH2 is responsible for individual differences in responses to drinking alcohol [MIM:610251]. Allele ALDH2*2 is associated with a very high incidence of acute alcohol intoxication in Orientals and South American Indians, as compared to Caucasians.
SNP ID | Clin | Chr 12 pos | Variation | AA Info | Type |
---|---|---|---|---|---|
rs671 | pathogenic, protective, risk-factor, Acute alcohol sensitivity, Alcohol dependence, Susceptibility to hangover, Sublingual nitroglycerin, susceptibility to poor response to, Esophageal cancer, alcohol-related, susceptibility to | 111,803,962(+) | G/A | coding_sequence_variant, missense_variant | |
rs1000057878 | -- | 111,802,832(+) | A/G | intron_variant | |
rs1000065244 | -- | 111,780,341(+) | A/G | intron_variant | |
rs1000100310 | -- | 111,765,123(+) | C/A | upstream_transcript_variant | |
rs1000171572 | -- | 111,766,663(+) | G/A | upstream_transcript_variant |
Variant ID | Type | Subtype | PubMed ID |
---|---|---|---|
dgv1556n100 | CNV | gain | 25217958 |
dgv2874n54 | CNV | gain | 21841781 |
dgv304e214 | CNV | gain | 21293372 |
dgv514e212 | CNV | gain | 25503493 |
esv2760710 | CNV | gain | 21179565 |
esv3630767 | CNV | loss | 21293372 |
nsv455715 | CNV | gain | 19166990 |
nsv470317 | CNV | gain | 18288195 |
nsv515716 | CNV | gain | 19592680 |
Additional Variant Information for ALDH2 Gene
Disorders for ALDH2 Gene

(24) MalaCards diseases for ALDH2 Gene - From: HGMD, OMIM, ClinVar, GTR, DISEASES, Novoseek, and GeneCards
Disorder | Aliases | PubMed IDs |
---|---|---|
alcohol sensitivity, acute |
|
|
alcohol use disorder |
|
|
alcohol dependence |
|
|
alcoholic neuropathy |
|
|
alcohol abuse |
|
Genatlas disease for ALDH2 Gene
Additional Disease Information for ALDH2
- Genetic Association Database
- (GAD)
- Human Genome Epidemiology Navigator
- (HuGE)
- ATLAS of Genetics and Cytogenetics in Oncology and Haematology
No data available for UniProtKB/Swiss-Prot for ALDH2 Gene
Publications for ALDH2 Gene
- The polymorphism in aldehyde dehydrogenase-2 gene is associated with elevated plasma levels of high-sensitivity C-reactive protein in the early phase of myocardial infarction. (PMID: 20467232) Bian Y … Zhang Y (The Tohoku journal of experimental medicine 2010) 3 22 44 58
- Genetic determinants of both ethanol and acetaldehyde metabolism influence alcohol hypersensitivity and drinking behaviour among Scandinavians. (PMID: 20205700) Linneberg A … Husemoen LL (Clinical and experimental allergy : journal of the British Society for Allergy and Clinical Immunology 2010) 3 22 44 58
- Association of ALDH2 genotypes with periodontitis progression. (PMID: 20042735) Nishida N … Shizukuishi S (Journal of dental research 2010) 3 22 44 58
- Absence of association on aldehyde dehydrogenase 2 (ALDH2) polymorphism with Mongolian Alzheimer patients. (PMID: 19914339) Zhou S … Ma X (Neuroscience letters 2010) 3 22 44 58
- ALDH2 genetic polymorphism and the risk of type II diabetes mellitus in CAD patients. (PMID: 19876063) Xu F … Zhang Y (Hypertension research : official journal of the Japanese Society of Hypertension 2010) 3 22 44 58
Products for ALDH2 Gene
- Browse R&D Systems for Antibodies
- Browse R&D Systems for Human Recombinant Proteins
- Browse R&D Systems for biochemical assays
- Browse Primary Antibodies
- Browse Proteins and Enzymes
- Browse ELISAs
- Browse Activity Assays
- Browse cDNA Clones
- Browse Cell Culture Products
- Browse Cell Selection and Detection Kits
- Browse DNA Damage and Repair Kits
- Browse ELISpot/FluoroSpot Kits and Development Modules
- Browse Flow Cytometry Kits
- Browse Immunoprecipitation Assays
- Browse Luminex Assays
- Browse Peptides
- Browse Proteome Profiler Antibody Arrays
- Browse Small Molecules
- Custom Antibody ServicesOriGene Antibodies for ALDH2
- Browse OriGene ELISA Kits
- Custom Assay Services
- OriGene Purified Proteins for ALDH2
- Search Origene for MassSpec and Protein Over-expression Lysates for ALDH2
- Origene Custom Protein Services for ALDH2
- Origene shrna, sirna, and RNAi products in human, mouse, rat for ALDH2
- Browse OriGene Inhibitory RNA Products For ALDH2
- OriGene qPCR primer pairs and template standards for ALDH2
- OriGene qPCR primer pairs for ALDH2
- OriGene CRISPR knockouts for ALDH2
- OriGene ORF clones in human for ALDH2
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For ALDH2
- GenScript: Next-day shipping of latest version cDNA ORF clones for ALDH2 in any vector
- GenScript Custom Purified and Recombinant Proteins Services for ALDH2
- GenScript Custom Assay Services for ALDH2
- GenScript Custom overexpressing Cell Line Services for ALDH2
- GenScript: Design CRISPR guide RNA sequences for ALDH2
- Design optimal peptide antigens
- CloneReady with Over 120,000 Genes
- Gene Synthesis: Any Gene in Any Vector
- Vector-based siRNA and miRNA, Ready for Transfection
- Gene Mutant Library, Variants up to 10^11
- Plasmid Preparation
- GenScript Custom Peptide Services for ALDH2
- Sino Biological Human cDNA Clone for ALDH2
- Browse Sino Biological Cell Lysates
- Browse Sino Biological Recombinant Proteins
- Browse Sino Biological Antibodies
- Browse Sino Biological Assays
- Browse Sino Biological ELISA Kits
- Browse Sino Biological ELISA Pair Sets
- Browse Sino Biological CRO Services
- Browse Sino Biological Control Vectors
- Sino Biological Transfection Reagent
- Sino Biological Anti-His Tag Antibody
- Novus Biologicals Antibodies for ALDH2
- Novus Biologicals lysates and proteins for ALDH2
- Novus Biologicals
- Novus Biologicals Tissue Microarrays
- Abcam antibodies for ALDH2
- Abcam proteins for ALDH2
- Find your target
- Browse Primary Antibodies
- Browse Conjugated Primary Antibodies
- Browse Secondary Antibodies
- Browse ELISA Kits
- Browse Matched Antibody Pairs
- Browse Proteins and Peptides
- Search Knockout (KO) Validated Antibodies
- Browse Monoclonal Antibodies
- Browse Recombinant Antibodies
- ProSpec Recombinant Proteins for ALDH2
- Cloud-Clone Corp. Antibodies for ALDH2
- Cloud-Clone Corp. Proteins for ALDH2
- Cloud-Clone Corp. Assay Kits for ALDH2
- Browse Knockouts at Cloud-Clone Corp.
- Browse Knockins at Cloud-Clone Corp.
- Cloud-Clone Corp. disease models service
- Browse cDNA clones at Cloud-Clone Corp.
- Browse primers at Cloud-Clone Corp.
- Cloud-Clone Corp. primary cells service
- Invitrogen Antibodies for ALDH2
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- ApexBio compounds for ALDH2
- antibodies-online: Search results for 177 available ALDH2 Antibodies ranked by validation data
- Compare Top ALDH2 Antibodies
- antibodies-online: Search results for 27 available ALDH2 Elisa Kits ranked by validation data
- Compare Top ALDH2 Elisa Kits
- antibodies-online: Search results for 16 available ALDH2 Proteins ranked by validation data
- Compare Top ALDH2 Proteins
- GeneTex ALDH2 antibody for ALDH2
- Search GeneTex for Proteins for ALDH2
- ViGene Biosciences adenoviral particle packaged cDNA for ALDH2 gene
- ViGene Biosciences lentiviral particle packaged cDNA for ALDH2 gene
- ViGene Biosciences ready-to-package AAV shRNAs for ALDH2 gene
- Search ViGene Biosciences for ALDH2
- Santa Cruz Biotechnology (SCBT) Antibodies for ALDH2
- Search Santa Cruz Biotechnology (SCBT) for ALDH2 siRNA/shRNA
- Santa Cruz Biotechnology (SCBT) CRISPR for ALDH2
- Horizon Cell Lines for ALDH2
- genomics-online: cdna clones - Search results for available ALDH2 gene related products
- orf clones - Search results for available ALDH2 gene related products
- genomics-online: gRNA clones - Search results for available ALDH2 gene related products
- genomics-online: primer clones - Search results for available ALDH2 gene related products
- genomics-online: shRNA clones - Search results for available ALDH2 gene related products
Sources for ALDH2 Gene
- (1) GeneCards
- (2) HGNC
- (3) EntrezGene
- (4) Swiss-Prot
- (5) Ensembl
- (6) OMIM
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) GO
- (12) TrEMBL
- (13) InterPro
- (14) ProtoNet
- (15) Blocks
- (16) MGI
- (17) IUBMB
- (18) KEGG
- (19) MINT
- (20) STRING
- (21) IntAct
- (22) Novoseek
- (23) PharmGKB
- (24) DrugBank
- (25) HMDB
- (26) UniGene
- (27) AceView
- (28) ASD
- (29) ECgene
- (30) GeneAnnot
- (31) CGAP SAGE
- (32) SOURCE
- (33) HomoloGene
- (34) PanEnsembl
- (35) euGenes
- (36) SGD
- (37) FlyBase
- (38) WormBase
- (39) Pseudogene
- (40) DGV
- (41) dbSNP
- (42) GenAtlas
- (43) HGMD
- (44) GAD
- (45) BGMUT
- (46) HuGE
- (47) Atlas
- (48) Cell Signaling Technology
- (49) GenBank
- (50) H-invDB
- (51) HORDE
- (52) HUGE
- (53) IMGT
- (54) Leiden
- (55) miRBase
- (56) DME
- (57) OriGene
- (58) PubMed
- (59) R&D Systems
- (60) TGDB
- (61) Tocris
- (62) Abcam
- (63) Novus Biologicals
- (64) ProSpec
- (65) Sino Biological
- (66) GenScript
- (67) Qiagen
- (68) Cloud-Clone Corp.
- (69) OCA
- (70) Proteopedia
- (71) MOPED
- (72) neXtProt
- (73) Reactome
- (74) GeneGo (Thomson Reuters)
- (75) fRNAdb
- (76) DISEASES
- (77) SIMAP
- (78) GenomeRNAi
- (79) LifeMap
- (80) miRTarBase
- (81) MalaCards
- (82) Invitrogen
- (83) BitterDB
- (84) Vector BioLabs
- (85) ESI-BIO
- (86) RefSeq
- (87) BioSystems
- (88) MaxQB
- (89) IUPHAR
- (90) BioGPS
- (91) Illumina
- (92) COMPARTMENTS
- (93) HOMER
- (94) PaxDb
- (95) ApexBio
- (96) Addgene
- (97) antibodies-online
- (98) CYP
- (99) NONCODE
- (100) SwitchGear Genomics
- (101) TreeFam
- (102) PathCards
- (103) GeneReviews
- (104) GeneTex
- (105) Taconic Biosciences
- (106) GTEx
- (107) ProteomicsDB
- (108) SCBT
- (109) DGIdb
- (110) ClinicalTrials
- (111) FDA Approved Drugs
- (112) RVIS
- (113) SIGNOR
- (114) diseasecard
- (115) NIH Rare Diseases
- (116) Orphanet
- (117) UMLS
- (118) GTR
- (119) Disease Ontology
- (120) Genetics Home Reference
- (121) MeSH
- (122) MedlinePlus
- (123) CDC
- (124) NINDS
- (125) NCBI Bookshelf
- (126) ClinVar
- (127) Gene Damage Index
- (128) ViGene Biosciences
- (129) HPO
- (130) UDN
- (131) VISTA
- (132) FANTOM5
- (133) ENCODE
- (134) ProSci
- (135) Horizon
- (136) NURSA
- (137) IID
- (138) Cyagen
- (139) VectorBuilder
- (140) SNPedia
- (141) BRCA Exchange
- (142) St John's Lab
- (143) CIViC
- (144) ProteoGenix
- (145) dbSUPER
- (146) TISSUES
- (147) Gene ORGANizer
- (148) abm
- (149) CrownBio
- (150) Human Protein Atlas
- (151) GWAS Catalog
- (152) Monarch Initiative
- (153) DataMed
- (154) HumanCyc
- (155) genomics-online
- (156) UCNEbase
- (157) EPDnew