Free for academic non-profit institutions. Other users need a Commercial license

Aliases for ALDH1A2 Gene

Aliases for ALDH1A2 Gene

  • Aldehyde Dehydrogenase 1 Family Member A2 2 3 5
  • Retinaldehyde-Specific Dehydrogenase Type 2 3 4
  • EC 1.2.1.36 4 61
  • RALDH(II) 3 4
  • RALDH 2 3 4
  • RALDH2 3 4
  • Aldehyde Dehydrogenase 1 Family, Member A2 2
  • Aldehyde Dehydrogenase Family 1 Member A2 4
  • Retinaldehyde Dehydrogenase 2 2
  • Retinal Dehydrogenase 2 3
  • RALDH2-T 3
  • EC 1.2.1 61

External Ids for ALDH1A2 Gene

Previous GeneCards Identifiers for ALDH1A2 Gene

  • GC15M053802
  • GC15M051292
  • GC15M055824
  • GC15M055961
  • GC15M056032
  • GC15M058245
  • GC15M035068

Summaries for ALDH1A2 Gene

Entrez Gene Summary for ALDH1A2 Gene

  • This protein belongs to the aldehyde dehydrogenase family of proteins. The product of this gene is an enzyme that catalyzes the synthesis of retinoic acid (RA) from retinaldehyde. Retinoic acid, the active derivative of vitamin A (retinol), is a hormonal signaling molecule that functions in developing and adult tissues. The studies of a similar mouse gene suggest that this enzyme and the cytochrome CYP26A1, concurrently establish local embryonic retinoic acid levels which facilitate posterior organ development and prevent spina bifida. Four transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, May 2011]

CIViC summary for ALDH1A2 Gene

GeneCards Summary for ALDH1A2 Gene

ALDH1A2 (Aldehyde Dehydrogenase 1 Family Member A2) is a Protein Coding gene. Diseases associated with ALDH1A2 include Congenital Diaphragmatic Hernia and Diaphragm Disease. Among its related pathways are Signaling by Retinoic Acid and Signaling by GPCR. GO annotations related to this gene include oxidoreductase activity and oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor. An important paralog of this gene is ALDH1A1.

UniProtKB/Swiss-Prot for ALDH1A2 Gene

  • Recognizes as substrates free retinal and cellular retinol-binding protein-bound retinal. Does metabolize octanal and decanal but does not metabolize citral, benzaldehyde, acetaldehyde and propanal efficiently (By similarity).

Tocris Summary for ALDH1A2 Gene

  • Aldehyde dehydrogenase enzymes oxidize aldehydes to generate carboxylic acids for use in the muscle and heart. Numerous aldehyde dehydrogenase genes exist, of which ALDH2 is best known for its role in alcohol oxidation.

Gene Wiki entry for ALDH1A2 Gene

No data available for PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for ALDH1A2 Gene

Genomics for ALDH1A2 Gene

Regulatory Elements for ALDH1A2 Gene

Enhancers for ALDH1A2 Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH15G058313 1.6 FANTOM5 Ensembl ENCODE dbSUPER 5.2 +183.4 183424 2.1 BCOR HDGF CBX3 TAL1 ZMYM3 TCF12 ADNP SMARCA5 ATF2 EP300 ALDH1A2 ENSG00000225798 LOC101928635 GC15M058232
GH15G057922 0.9 Ensembl ENCODE 6.4 +574.5 574485 1.6 CTCF JUND ATF3 HNF4G HNF4A RAD21 NR2F2 YY1 ALDH1A2 GC15M057895 GC15M057957 GC15M057958
GH15G058039 1.2 ENCODE 4.5 +458.5 458505 2.2 CREB3L1 MLX DMAP1 FEZF1 YY1 SP3 NFYC TBX21 MEF2D ZNF610 ALDH1A2 PIR51557 ENSG00000274719
GH15G058061 1.1 ENCODE 4.9 +433.5 433528 5.4 PKNOX1 AGO1 SIN3A FEZF1 ZNF2 YY1 ZNF766 ZNF143 FOS ZNF263 ALDH1A2 PIR51557 ENSG00000274719
GH15G058310 0.8 ENCODE dbSUPER 5.5 +187.4 187394 0.7 MAFF ZNF316 MAFG RAD21 EMSY MAFK ALDH1A2 LOC101928635 GC15M058232
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around ALDH1A2 on UCSC Golden Path with GeneCards custom track

Genomic Location for ALDH1A2 Gene

Chromosome:
15
Start:
57,953,424 bp from pter
End:
58,497,866 bp from pter
Size:
544,443 bases
Orientation:
Minus strand

Genomic View for ALDH1A2 Gene

Genes around ALDH1A2 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
ALDH1A2 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for ALDH1A2 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for ALDH1A2 Gene

Proteins for ALDH1A2 Gene

  • Protein details for ALDH1A2 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    O94788-AL1A2_HUMAN
    Recommended name:
    Retinal dehydrogenase 2
    Protein Accession:
    O94788
    Secondary Accessions:
    • B3KY52
    • B4DZR2
    • F5H2Y9
    • H0YM00
    • Q2PJS6
    • Q8NHQ4
    • Q9UBR8
    • Q9UFY0

    Protein attributes for ALDH1A2 Gene

    Size:
    518 amino acids
    Molecular mass:
    56724 Da
    Quaternary structure:
    • Homotetramer.

    Three dimensional structures from OCA and Proteopedia for ALDH1A2 Gene

    Alternative splice isoforms for ALDH1A2 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for ALDH1A2 Gene

Selected DME Specific Peptides for ALDH1A2 Gene

O94788:
  • EGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFG
  • QIIPWNFP
  • GPTAGAAI
  • TLELGGK
  • GWADKIHG
  • EGAKLECGG
  • LADLVERD
  • RHEPIGV
  • RSVERAK
  • MRIAKEEIFGPV
  • RYYAGWADK
  • VTLELGG
  • GYGPTAG
  • FFNQGQCC
  • EAGFPPGV
  • AARLAFSLGSVWRRMDASERG
  • VYNPATG
  • AQSPFGG
  • AAGRSNLK
  • LLDKLADLVERDRA
  • PWNFPLLM
  • GLREYSEVKTVT
  • FVEESIY
  • GAAIASH
  • NLEIKYTKIFINNEWQNSESGR
  • TKIFINNEW
  • KPAEQTPL
  • GIDKIAFTGSTEVGKLIQEAAGRSNLKRVTLELGGKSPNI
  • PFGGFKMSGNGRE
  • MPGEVKADPAALMASL

Post-translational modifications for ALDH1A2 Gene

  • Ubiquitination at posLast=108108, posLast=156156, posLast=269269, posLast=290290, posLast=370370, Lys384, posLast=390390, posLast=395395, Lys415, and posLast=429429
  • Modification sites at PhosphoSitePlus

Antibody Products

  • Abcam antibodies for ALDH1A2
  • Cloud-Clone Corp. Antibodies for ALDH1A2

Domains & Families for ALDH1A2 Gene

Gene Families for ALDH1A2 Gene

Suggested Antigen Peptide Sequences for ALDH1A2 Gene

Graphical View of Domain Structure for InterPro Entry

O94788

UniProtKB/Swiss-Prot:

AL1A2_HUMAN :
  • Belongs to the aldehyde dehydrogenase family.
Family:
  • Belongs to the aldehyde dehydrogenase family.
genes like me logo Genes that share domains with ALDH1A2: view

Function for ALDH1A2 Gene

Molecular function for ALDH1A2 Gene

UniProtKB/Swiss-Prot CatalyticActivity:
Retinal + NAD(+) + H(2)O = retinoate + NADH.
UniProtKB/Swiss-Prot Function:
Recognizes as substrates free retinal and cellular retinol-binding protein-bound retinal. Does metabolize octanal and decanal but does not metabolize citral, benzaldehyde, acetaldehyde and propanal efficiently (By similarity).

Enzyme Numbers (IUBMB) for ALDH1A2 Gene

Gene Ontology (GO) - Molecular Function for ALDH1A2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0001758 retinal dehydrogenase activity TAS --
GO:0004028 3-chloroallyl aldehyde dehydrogenase activity ISS --
GO:0004029 aldehyde dehydrogenase (NAD) activity IBA --
GO:0016491 oxidoreductase activity IEA --
GO:0016620 oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor IEA --
genes like me logo Genes that share ontologies with ALDH1A2: view
genes like me logo Genes that share phenotypes with ALDH1A2: view

Animal Models for ALDH1A2 Gene

MGI Knock Outs for ALDH1A2:

Animal Model Products

CRISPR Products

Inhibitory RNA Products

Flow Cytometry Products

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for ALDH1A2 Gene

Localization for ALDH1A2 Gene

Subcellular locations from UniProtKB/Swiss-Prot for ALDH1A2 Gene

Cytoplasm.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for ALDH1A2 gene
Compartment Confidence
cytosol 5
peroxisome 2
nucleus 2
extracellular 1
cytoskeleton 1
mitochondrion 1

Gene Ontology (GO) - Cellular Components for ALDH1A2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005737 cytoplasm IEA,IDA 18495959
GO:0005829 cytosol TAS --
GO:0048471 perinuclear region of cytoplasm IEA --
genes like me logo Genes that share ontologies with ALDH1A2: view

Pathways & Interactions for ALDH1A2 Gene

genes like me logo Genes that share pathways with ALDH1A2: view

Pathways by source for ALDH1A2 Gene

2 KEGG pathways for ALDH1A2 Gene
1 GeneGo (Thomson Reuters) pathway for ALDH1A2 Gene

UniProtKB/Swiss-Prot O94788-AL1A2_HUMAN

  • Pathway: Cofactor metabolism; retinol metabolism.

Gene Ontology (GO) - Biological Process for ALDH1A2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0001568 blood vessel development IEA --
GO:0001822 kidney development IEA --
GO:0001889 liver development IEA --
GO:0001936 regulation of endothelial cell proliferation IEA --
GO:0002138 retinoic acid biosynthetic process IEA --
genes like me logo Genes that share ontologies with ALDH1A2: view

No data available for SIGNOR curated interactions for ALDH1A2 Gene

Drugs & Compounds for ALDH1A2 Gene

(13) Drugs for ALDH1A2 Gene - From: DrugBank, PharmGKB, ApexBio, HMDB, Tocris, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Vitamin A Approved, Vet_approved Nutra Target 492
Tretinoin Approved, Investigational Nutra Target 228
Cyclophosphamide Approved, Investigational Pharma Nitrogen mustard alkylating agent and prodrug. 2935
FAD Approved Pharma 0
Isotretinoin Approved Pharma 124

(13) Additional Compounds for ALDH1A2 Gene - From: HMDB, Novoseek, and Tocris

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
9-cis-Retinal
  • 9-cis-Retinal
  • 9-cis-Retinaldehyde
  • 9-cis-Vitamin A aldehyde
  • cis-9-Retinal
  • Isoretinene A
514-85-2
9-cis-retinoic acid
  • 15-Apo-beta-caroten-15-oate
  • 15-Apo-beta-caroten-15-oic acid
  • 9-cis-Retinoate
  • 9-cis-Retinoic acid
  • 9-cis-Tretinoin
Agonist
all-trans-retinoic acid
  • (all-E)-3,7-Dimethyl-9-(2,6,6-trimethyl-1-cyclohexen-1-yl)-2,4,6,8-nonatetraenoate
  • (all-E)-3,7-Dimethyl-9-(2,6,6-trimethyl-1-cyclohexen-1-yl)-2,4,6,8-nonatetraenoic acid
  • 3,7-Dimethyl-9-(2,6,6-trimethyl-1-cyclohexen-1-yl)-2,4,6,8-nonatetraenoate
  • 3,7-Dimethyl-9-(2,6,6-trimethyl-1-cyclohexen-1-yl)-2,4,6,8-nonatetraenoic acid
  • Acide retinoique (French)
Full agonist, Agonist 302-79-4
Decanal
  • 1-Decanal
  • 1-Decanal(mixed isomers)
  • 1-Decyl aldehyde
  • Aldehyde c10
  • C-10 Aldehyde
112-31-2
Hydrogen Ion
  • Hydrogen cation
  • Hydron
  • Proton

(4) Tocris Compounds for ALDH1A2 Gene

Compound Action Cas Number
A37 ALDH1A1 inhibitor 896795-60-1
Alda 1 ALDH2 activator; cardioprotective 349438-38-6
CVT 10216 Potent and selective ALDH2 inhibitor 1005334-57-5
WIN 18446 ALDH1a2 inhibitor 1477-57-2

(2) ApexBio Compounds for ALDH1A2 Gene

Compound Action Cas Number
CVT 10216 1005334-57-5
Cyclophosphamide Nitrogen mustard alkylating agent and prodrug. 50-18-0
genes like me logo Genes that share compounds with ALDH1A2: view

Transcripts for ALDH1A2 Gene

Unigene Clusters for ALDH1A2 Gene

Aldehyde dehydrogenase 1 family, member A2:
Representative Sequences:

CRISPR Products

Inhibitory RNA Products

Flow Cytometry Products

Alternative Splicing Database (ASD) splice patterns (SP) for ALDH1A2 Gene

ExUns: 1a · 1b ^ 2 ^ 3 ^ 4 ^ 5 ^ 6 ^ 7 ^ 8 ^ 9 ^ 10 ^ 11 ^ 12 ^ 13
SP1:
SP2: -

Relevant External Links for ALDH1A2 Gene

GeneLoc Exon Structure for
ALDH1A2
ECgene alternative splicing isoforms for
ALDH1A2

Expression for ALDH1A2 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for ALDH1A2 Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

mRNA differential expression in normal tissues according to GTEx for ALDH1A2 Gene

This gene is overexpressed in Cervix - Ectocervix (x6.9), Uterus (x6.2), and Cervix - Endocervix (x4.4).

Protein differential expression in normal tissues from HIPED for ALDH1A2 Gene

This gene is overexpressed in Seminal vesicle (39.5) and Uterus (6.5).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for ALDH1A2 Gene



NURSA nuclear receptor signaling pathways regulating expression of ALDH1A2 Gene:

ALDH1A2

SOURCE GeneReport for Unigene cluster for ALDH1A2 Gene:

Hs.643455

Evidence on tissue expression from TISSUES for ALDH1A2 Gene

  • Nervous system(2.7)
  • Blood(2.4)
  • Heart(2.3)
  • Muscle(2.1)
  • Lung(2)
genes like me logo Genes that share expression patterns with ALDH1A2: view

Primer Products

No data available for Protein tissue co-expression partners , mRNA Expression by UniProt/SwissProt and Phenotype-based relationships between genes and organs from Gene ORGANizer for ALDH1A2 Gene

Orthologs for ALDH1A2 Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for ALDH1A2 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia ALDH1A2 34 35
  • 99.42 (n)
oppossum
(Monodelphis domestica)
Mammalia ALDH1A2 35
  • 97 (a)
OneToOne
dog
(Canis familiaris)
Mammalia ALDH1A2 34 35
  • 94.21 (n)
cow
(Bos Taurus)
Mammalia ALDH1A2 34 35
  • 93.5 (n)
rat
(Rattus norvegicus)
Mammalia Aldh1a2 34
  • 90.41 (n)
mouse
(Mus musculus)
Mammalia Aldh1a2 34 16 35
  • 90.22 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia ALDH1A2 35
  • 83 (a)
OneToOne
chicken
(Gallus gallus)
Aves ALDH1A2 34 35
  • 83.03 (n)
lizard
(Anolis carolinensis)
Reptilia ALDH1A2 35
  • 86 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia aldh1a2 34
  • 80.69 (n)
Str.6273 34
African clawed frog
(Xenopus laevis)
Amphibia Xl.8908 34
zebrafish
(Danio rerio)
Actinopterygii aldh1a2 34 35
  • 73.1 (n)
fruit fly
(Drosophila melanogaster)
Insecta CG3752 36
  • 64 (a)
Aldh 35
  • 62 (a)
OneToMany
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes ALD6 34
  • 53.8 (n)
K. lactis yeast
(Kluyveromyces lactis)
Saccharomycetes KLLA0E23057g 34
  • 53.42 (n)
Alicante grape
(Vitis vinifera)
eudicotyledons Vvi.465 34
barley
(Hordeum vulgare)
Liliopsida Hv.727 34
sea squirt
(Ciona savignyi)
Ascidiacea CSA.8824 35
  • 65 (a)
OneToMany
Species where no ortholog for ALDH1A2 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African malaria mosquito (Anopheles gambiae)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)
  • worm (Caenorhabditis elegans)

Evolution for ALDH1A2 Gene

ENSEMBL:
Gene Tree for ALDH1A2 (if available)
TreeFam:
Gene Tree for ALDH1A2 (if available)

Paralogs for ALDH1A2 Gene

genes like me logo Genes that share paralogs with ALDH1A2: view

Variants for ALDH1A2 Gene

Sequence variations from dbSNP and Humsavar for ALDH1A2 Gene

SNP ID Clin Chr 15 pos Sequence Context AA Info Type
rs1000050330 -- 57,990,472(+) TGATG(C/T)AAGAG intron-variant
rs1000061772 -- 58,065,235(+) AGTCG(A/G)GACCG intron-variant
rs1000073619 -- 58,011,949(+) CTGCC(G/T)ACACC intron-variant
rs1000082056 -- 57,975,521(+) AAAAT(G/T)CTCCA intron-variant
rs1000151899 -- 58,027,484(+) AGCAC(C/T)TCTTC intron-variant

Structural Variations from Database of Genomic Variants (DGV) for ALDH1A2 Gene

Variant ID Type Subtype PubMed ID
dgv12e194 CNV deletion 18987734
esv1602894 CNV deletion 17803354
esv2533857 CNV deletion 19546169
esv2658819 CNV deletion 23128226
esv2749738 CNV deletion 23290073
esv2749739 CNV deletion 23290073
esv3191417 CNV deletion 24192839
esv3552508 CNV deletion 23714750
esv3636619 CNV loss 21293372
esv3892701 CNV loss 25118596
esv4077 CNV loss 18987735
nsv1122970 CNV deletion 24896259
nsv1152648 CNV deletion 26484159
nsv569593 CNV loss 21841781
nsv569594 CNV loss 21841781
nsv569595 CNV loss 21841781
nsv569596 CNV loss 21841781
nsv7266 OTHER inversion 18451855
nsv833023 CNV gain 17160897
nsv976939 CNV duplication 23825009

Variation tolerance for ALDH1A2 Gene

Residual Variation Intolerance Score: 11.7% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 11.86; 93.49% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for ALDH1A2 Gene

Human Gene Mutation Database (HGMD)
ALDH1A2
SNPedia medical, phenotypic, and genealogical associations of SNPs for
ALDH1A2

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for ALDH1A2 Gene

Disorders for ALDH1A2 Gene

MalaCards: The human disease database

(3) MalaCards diseases for ALDH1A2 Gene - From: DISEASES, Novoseek, and GeneCards

Disorder Aliases PubMed IDs
congenital diaphragmatic hernia
  • diaphragmatic hernia
diaphragm disease
  • disease of diaphragm
neural tube defects
  • spina bifida
- elite association - COSMIC cancer census association via MalaCards

Relevant External Links for ALDH1A2

Genetic Association Database (GAD)
ALDH1A2
Human Genome Epidemiology (HuGE) Navigator
ALDH1A2
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
ALDH1A2
genes like me logo Genes that share disorders with ALDH1A2: view

No data available for UniProtKB/Swiss-Prot and Genatlas for ALDH1A2 Gene

Publications for ALDH1A2 Gene

  1. Positive association between ALDH1A2 and schizophrenia in the Chinese population. (PMID: 19703508) Wan C. … He L. (Prog. Neuropsychopharmacol. Biol. Psychiatry 2009) 3 22 46 64
  2. ALDH1A2 (RALDH2) genetic variation in human congenital heart disease. (PMID: 19886994) Pavan M. … Xavier-Neto J. (BMC Med. Genet. 2009) 3 22 46 64
  3. Analysis of ALDH1A2, CYP26A1, CYP26B1, CRABP1, and CRABP2 in human neural tube defects suggests a possible association with alleles in ALDH1A2. (PMID: 16237707) Deak K.L. … Speer M.C. (Birth Defects Res. Part A Clin. Mol. Teratol. 2005) 3 22 46 64
  4. TAL1 and LIM-only proteins synergistically induce retinaldehyde dehydrogenase 2 expression in T-cell acute lymphoblastic leukemia by acting as cofactors for GATA3. (PMID: 9819382) Ono Y. … Yoshie O. (Mol. Cell. Biol. 1998) 2 3 4 64
  5. Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score. (PMID: 20379614) Rose J.E. … Uhl G.R. (Mol. Med. 2010) 3 46 64

Products for ALDH1A2 Gene

Sources for ALDH1A2 Gene

Content
Loading form....