Free for academic non-profit institutions. Other users need a Commercial license

Aliases for AHCY Gene

Aliases for AHCY Gene

  • Adenosylhomocysteinase 2 3 3 5
  • S-Adenosyl-L-Homocysteine Hydrolase 3 4
  • S-Adenosylhomocysteine Hydrolase 2 3
  • EC 3.3.1.1 4 58
  • AdoHcyase 3 4
  • SAHH 3 4

External Ids for AHCY Gene

Previous GeneCards Identifiers for AHCY Gene

  • GC20M032626
  • GC20M033491
  • GC20M033583
  • GC20M032331
  • GC20M032868
  • GC20M029649
  • GC20M034280

Summaries for AHCY Gene

Entrez Gene Summary for AHCY Gene

  • S-adenosylhomocysteine hydrolase belongs to the adenosylhomocysteinase family. It catalyzes the reversible hydrolysis of S-adenosylhomocysteine (AdoHcy) to adenosine (Ado) and L-homocysteine (Hcy). Thus, it regulates the intracellular S-adenosylhomocysteine (SAH) concentration thought to be important for transmethylation reactions. Deficiency in this protein is one of the different causes of hypermethioninemia. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2009]

GeneCards Summary for AHCY Gene

AHCY (Adenosylhomocysteinase) is a Protein Coding gene. Diseases associated with AHCY include Hypermethioninemia With Deficiency Of S-Adenosylhomocysteine Hydrolase and Hypermethioninemia. Among its related pathways are Metabolism and One carbon pool by folate. GO annotations related to this gene include identical protein binding and adenyl nucleotide binding. An important paralog of this gene is AHCYL2.

UniProtKB/Swiss-Prot for AHCY Gene

  • Adenosylhomocysteine is a competitive inhibitor of S-adenosyl-L-methionine-dependent methyl transferase reactions; therefore adenosylhomocysteinase may play a key role in the control of methylations via regulation of the intracellular concentration of adenosylhomocysteine.

Additional gene information for AHCY Gene

No data available for CIViC summary , Tocris Summary , Gene Wiki entry , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for AHCY Gene

Genomics for AHCY Gene

Regulatory Elements for AHCY Gene

Enhancers for AHCY Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH20H033991 1.4 ENCODE dbSUPER 5.6 +317.9 317929 4 HDGF PKNOX1 MLX ZFP64 ARID4B SIN3A DMAP1 ZNF2 YY1 SLC30A9 ENSG00000228386 ENSG00000229188 BPIFB5P BPIFA3 ENSG00000224876 SUN5 RPL12P3 RPS2P1 CDK5RAP1 ENSG00000272945
GH20H034313 1.2 Ensembl ENCODE 5.5 -3.4 -3378 3 ARID4B RAD21 DNMT3B RARA SLC30A9 FOS EGR2 SMARCC1 KAT8 ZNF592 MAP1LC3A MMP24-AS1 RALY-AS1 AHCY GGT7 ENSG00000234087
GH20H033517 1.2 Ensembl ENCODE dbSUPER 4.7 +793.6 793590 1 JUN INSM2 KLF17 ZEB2 OSR2 PRDM6 BCL11A ZSCAN5C GLIS1 ZNF600 CBFA2T2 SNTA1 AHCY BPIFB9P GC20P033492 GC20P033491 GC20P033562
GH20H034300 1.2 ENCODE 4.6 +9.7 9731 3 HDGF FOXA2 MLX ARNT ZFP64 ARID4B SIN3A FEZF1 DMAP1 YY1 ENSG00000228386 ENSG00000229188 BPIFB5P NCOA6 CDK5RAP1 RPS2P1 CBFA2T2 TRPC4AP EIF6 AHCY
GH20H033684 1.1 ENCODE 4.7 +626.1 626076 2 HDGF MLX ARID4B SIN3A DMAP1 SLC30A9 ZNF143 FOS SP3 CEBPZ ZNF341-AS1 ENSG00000229188 ENSG00000228386 BPIFB5P RPL12P3 BPIFA3 ENSG00000224876 SUN5 EIF2S2 RPS2P1
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around AHCY on UCSC Golden Path with GeneCards custom track

Promoters for AHCY Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00000136391 -724 201 MLX ZFP64 ARID4B SIN3A ZNF2 SLC30A9 ZNF143 DEK SP3 MXD4

Genomic Location for AHCY Gene

Chromosome:
20
Start:
34,234,840 bp from pter
End:
34,311,976 bp from pter
Size:
77,137 bases
Orientation:
Minus strand

Genomic View for AHCY Gene

Genes around AHCY on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
AHCY Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for AHCY Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for AHCY Gene

Proteins for AHCY Gene

  • Protein details for AHCY Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    P23526-SAHH_HUMAN
    Recommended name:
    Adenosylhomocysteinase
    Protein Accession:
    P23526
    Secondary Accessions:
    • A8K307
    • B3KUN3
    • E1P5P2
    • F5H737
    • Q96A36

    Protein attributes for AHCY Gene

    Size:
    432 amino acids
    Molecular mass:
    47716 Da
    Cofactor:
    Name=NAD(+); Xref=ChEBI:CHEBI:57540;
    Quaternary structure:
    • Homotetramer.

    Three dimensional structures from OCA and Proteopedia for AHCY Gene

    Alternative splice isoforms for AHCY Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for AHCY Gene

Selected DME Specific Peptides for AHCY Gene

P23526:
  • AVVAGYGDVGKG
  • CNIGHFD
  • DGIKRATD
  • IKRATDVM
  • GRLVNLG
  • RATDVMIAGK
  • GARVIITE
  • LPKKLDE
  • TKSKFDNLYGCRESL
  • NIKPQVD
  • YSASKPLKG
  • GHFDVEI
  • KPQVDRY
  • EETTTGV
  • AQIELWT
  • GYGDVGKGCA
  • EGRLVNL
  • LDDGGDLT
  • LKVPAIN
  • GHPSFVMSNSF
  • ITEIDPI
  • NMILDDGGD
  • PLKGARI
  • NVNDSVTK
  • WCIEQTL
  • DVKWLNENAV
  • AWKGETDEEY
  • DPINALQA
  • AGKVAVV
  • DKLPYKVADIGLAAWGRKALDIAENEMPGLMRMRE
  • GARIAGCLHMT
  • EGNIFVT
  • ALQAAMEG
  • IFVTTTG
  • SCNIFSTQ

Post-translational modifications for AHCY Gene

  • Ubiquitination at Lys8, posLast=2020, Lys166, posLast=188188, Lys226, and Lys412
  • Modification sites at PhosphoSitePlus

Antibody Products

  • R&D Systems Antibodies for AHCY (Adenosylhomocysteinase/AHCY)

Domains & Families for AHCY Gene

Gene Families for AHCY Gene

IUPHAR :
Human Protein Atlas (HPA):
  • Disease related genes
  • Enzymes
  • Plasma proteins
  • Potential drug targets
  • Predicted intracellular proteins

Suggested Antigen Peptide Sequences for AHCY Gene

Graphical View of Domain Structure for InterPro Entry

P23526

UniProtKB/Swiss-Prot:

SAHH_HUMAN :
  • Belongs to the adenosylhomocysteinase family.
Family:
  • Belongs to the adenosylhomocysteinase family.
genes like me logo Genes that share domains with AHCY: view

Function for AHCY Gene

Molecular function for AHCY Gene

GENATLAS Biochemistry:
S-adenosyl-homocysteine hydrolase,sulfur aminoacid metabolism,transmethylation pathway
UniProtKB/Swiss-Prot CatalyticActivity:
S-adenosyl-L-homocysteine + H(2)O = L-homocysteine + adenosine.
UniProtKB/Swiss-Prot Function:
Adenosylhomocysteine is a competitive inhibitor of S-adenosyl-L-methionine-dependent methyl transferase reactions; therefore adenosylhomocysteinase may play a key role in the control of methylations via regulation of the intracellular concentration of adenosylhomocysteine.

Enzyme Numbers (IUBMB) for AHCY Gene

Phenotypes From GWAS Catalog for AHCY Gene

Gene Ontology (GO) - Molecular Function for AHCY Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004013 adenosylhomocysteinase activity TAS 2596825
GO:0005515 protein binding IPI 25416956
GO:0016787 hydrolase activity IEA --
GO:0030554 adenyl nucleotide binding IEA --
GO:0042802 identical protein binding IEA --
genes like me logo Genes that share ontologies with AHCY: view
genes like me logo Genes that share phenotypes with AHCY: view

Human Phenotype Ontology for AHCY Gene

HPO Id HPO Name Alternative Ids Definition Synonyms

Animal Models for AHCY Gene

MGI Knock Outs for AHCY:
  • Ahcy tm1b(EUCOMM)Hmgu

Animal Model Products

  • Taconic Biosciences Mouse Models for AHCY

CRISPR Products

Inhibitory RNA Products

Clone Products

  • Addgene plasmids for AHCY
  • Applied Biological Materials Clones for AHCY
  • Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more

No data available for Transcription Factor Targets and HOMER Transcription for AHCY Gene

Localization for AHCY Gene

Subcellular locations from UniProtKB/Swiss-Prot for AHCY Gene

Cytoplasm. Melanosome. Note=Identified by mass spectrometry in melanosome fractions from stage I to stage IV.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for AHCY gene
Compartment Confidence
extracellular 5
cytosol 5
nucleus 3
plasma membrane 2
mitochondrion 2
cytoskeleton 1

Subcellular locations from the

Human Protein Atlas (HPA)

Gene Ontology (GO) - Cellular Components for AHCY Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005634 nucleus IEA --
GO:0005737 cytoplasm IEA --
GO:0005829 cytosol TAS,IBA --
GO:0042470 melanosome IEA --
GO:0043005 neuron projection IEA --
genes like me logo Genes that share ontologies with AHCY: view

Pathways & Interactions for AHCY Gene

genes like me logo Genes that share pathways with AHCY: view

UniProtKB/Swiss-Prot P23526-SAHH_HUMAN

  • Pathway: Amino-acid biosynthesis; L-homocysteine biosynthesis; L-homocysteine from S-adenosyl-L-homocysteine: step 1/1.

Gene Ontology (GO) - Biological Process for AHCY Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000096 sulfur amino acid metabolic process TAS --
GO:0001666 response to hypoxia IEA --
GO:0002439 chronic inflammatory response to antigenic stimulus IEA --
GO:0006730 one-carbon metabolic process IEA --
GO:0007584 response to nutrient IEA --
genes like me logo Genes that share ontologies with AHCY: view

No data available for SIGNOR curated interactions for AHCY Gene

Drugs & Compounds for AHCY Gene

(25) Drugs for AHCY Gene - From: DrugBank, DGIdb, IUPHAR, HMDB, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Isopropyl alcohol Approved Pharma Target 0
Copper Approved Pharma Target, allosteric modulator 188
Adenosine Approved, Investigational Pharma Agonist 528
Water Approved Pharma 0
D-Eritadenine Experimental Pharma Target 0

(22) Additional Compounds for AHCY Gene - From: Novoseek and HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
homocysteine
  • (+-)-homocysteine
  • (S)-2-amino-4-mercapto-Butanoate
  • (S)-2-amino-4-mercapto-Butanoic acid
  • 2-Amino-4-mercapto-Butanoate
  • 2-Amino-4-mercapto-Butanoic acid
454-29-5
s-adenosylmethionine
  • (3S)-5'-[(3-amino-3-carboxypropyl)methylsulfonio]-5'-deoxyadenosine
  • 2-S-Adenosyl-L-methionine
  • 5'-Deoxyadenosine-5'-L-methionine disulfate ditosylate
  • 5'-Deoxyadenosine-5'-L-methionine disulphate ditosylate
  • Active methionine
29908-03-0
Se-Adenosylselenohomocysteine
Selenohomocysteine
  • 2-Amino-4-selanyl-butanoate
  • 2-Amino-4-selanyl-butanoic acid
  • Se-selenocysteine
29412-93-9
genes like me logo Genes that share compounds with AHCY: view

Transcripts for AHCY Gene

Unigene Clusters for AHCY Gene

Adenosylhomocysteinase:
Representative Sequences:

CRISPR Products

Inhibitory RNA Products

Clone Products

  • Addgene plasmids for AHCY
  • Applied Biological Materials Clones for AHCY
  • Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more

Alternative Splicing Database (ASD) splice patterns (SP) for AHCY Gene

ExUns: 1a · 1b · 1c · 1d ^ 2 ^ 3 ^ 4a · 4b · 4c ^ 5a · 5b ^ 6 ^ 7 ^ 8 ^ 9a · 9b ^ 10 ^ 11a · 11b ^ 12 ^ 13 ^ 14
SP1: - - - -
SP2: - - - -
SP3: -
SP4: - -
SP5:
SP6: - - -
SP7: - -
SP8: -

Relevant External Links for AHCY Gene

GeneLoc Exon Structure for
AHCY
ECgene alternative splicing isoforms for
AHCY

Expression for AHCY Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for AHCY Gene

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for AHCY Gene



Protein tissue co-expression partners for AHCY Gene

- Elite partner

NURSA nuclear receptor signaling pathways regulating expression of AHCY Gene:

AHCY

SOURCE GeneReport for Unigene cluster for AHCY Gene:

Hs.388004

Evidence on tissue expression from TISSUES for AHCY Gene

  • Nervous system(4.9)
  • Liver(4.8)
  • Skin(4.8)
  • Blood(4.6)
  • Kidney(4.4)
  • Intestine(3.8)
  • Lung(3.8)
  • Eye(3.4)
  • Heart(2.3)
  • Muscle(2.2)
  • Spleen(2.1)

Phenotype-based relationships between genes and organs from Gene ORGANizer for AHCY Gene

Germ Layers:
  • ectoderm
  • mesoderm
Systems:
  • cardiovascular
  • nervous
  • skeletal muscle
  • skeleton
Organs:
Head and neck:
  • brain
  • ear
  • face
  • head
  • jaw
  • mandible
  • maxilla
  • mouth
  • skull
  • tooth
Thorax:
  • heart
  • heart valve
genes like me logo Genes that share expression patterns with AHCY: view

Primer Products

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA differential expression in normal tissues , Protein differential expression in normal tissues and mRNA Expression by UniProt/SwissProt for AHCY Gene

Orthologs for AHCY Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for AHCY Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia AHCY 33 34
  • 99.69 (n)
mouse
(Mus musculus)
Mammalia Gm4737 34
  • 97 (a)
OneToMany
Ahcy 33 16 34
  • 91.2 (n)
cow
(Bos Taurus)
Mammalia AHCY 33 34
  • 92.44 (n)
oppossum
(Monodelphis domestica)
Mammalia AHCY 34
  • 92 (a)
OneToOne
rat
(Rattus norvegicus)
Mammalia Ahcy 33
  • 91.36 (n)
dog
(Canis familiaris)
Mammalia AHCY 33 34
  • 86.88 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia AHCY 34
  • 84 (a)
OneToOne
chicken
(Gallus gallus)
Aves AHCY 33 34
  • 80.86 (n)
lizard
(Anolis carolinensis)
Reptilia AHCY 34
  • 89 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia ahcy 33
  • 78.24 (n)
Str.6107 33
African clawed frog
(Xenopus laevis)
Amphibia Xl.937 33
zebrafish
(Danio rerio)
Actinopterygii ahcy 33 34
  • 78.86 (n)
rainbow trout
(Oncorhynchus mykiss)
Actinopterygii Omy.8276 33
fruit fly
(Drosophila melanogaster)
Insecta Ahcy13 35 33 34
  • 76.07 (n)
African malaria mosquito
(Anopheles gambiae)
Insecta SAHH_ANOGA 33
  • 75.6 (n)
worm
(Caenorhabditis elegans)
Secernentea dpy-14 35
  • 76 (a)
ahcy-1 33 34
  • 70.01 (n)
A. gosspyii yeast
(Ashbya gossypii)
Saccharomycetes AGOS_AFR243C 33
  • 69.95 (n)
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes SAH1 33 34 36
  • 64.87 (n)
K. lactis yeast
(Kluyveromyces lactis)
Saccharomycetes KLLA0A01199g 33
  • 64.79 (n)
thale cress
(Arabidopsis thaliana)
eudicotyledons MEE58 33
  • 62.36 (n)
Alicante grape
(Vitis vinifera)
eudicotyledons Vvi.757 33
rice
(Oryza sativa)
Liliopsida Os11g0455500 33
  • 66.28 (n)
Os.8240 33
barley
(Hordeum vulgare)
Liliopsida Hv.3364 33
wheat
(Triticum aestivum)
Liliopsida Ta.1258 33
corn
(Zea mays)
Liliopsida Zm.10189 33
bread mold
(Neurospora crassa)
Ascomycetes NCU07930 33
  • 71.99 (n)
fission yeast
(Schizosaccharomyces pombe)
Schizosaccharomycetes SPBC8D2.18c 33
  • 68.54 (n)
sea squirt
(Ciona savignyi)
Ascidiacea -- 34
  • 68 (a)
ManyToMany
sea squirt
(Ciona intestinalis)
Ascidiacea Cin.5073 33
Species where no ortholog for AHCY was found in the sources mined by GeneCards:
  • Actinobacteria (Mycobacterium tuberculosis)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • beta proteobacteria (Neisseria meningitidis)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)

Evolution for AHCY Gene

ENSEMBL:
Gene Tree for AHCY (if available)
TreeFam:
Gene Tree for AHCY (if available)

Paralogs for AHCY Gene

Paralogs for AHCY Gene

(2) SIMAP similar genes for AHCY Gene using alignment to 2 proteins:

genes like me logo Genes that share paralogs with AHCY: view

Variants for AHCY Gene

Sequence variations from dbSNP and Humsavar for AHCY Gene

SNP ID Clin Chr 20 pos Sequence Context AA Info Type
rs121918608 Pathogenic, Hypermethioninemia with S-adenosylhomocysteine hydrolase deficiency (HMAHCHD) [MIM:613752] 34,292,375(-) CAAGT(A/G)CCCGC reference, missense
rs369428934 Hypermethioninemia with S-adenosylhomocysteine hydrolase deficiency (HMAHCHD) [MIM:613752] 34,295,469(+) GATGC(A/G)GGCGC reference, missense, utr-variant-5-prime
rs755222515 Hypermethioninemia with S-adenosylhomocysteine hydrolase deficiency (HMAHCHD) [MIM:613752] 34,294,110(+) CAGCC(A/G)CCGCA reference, missense, utr-variant-5-prime
rs773162208 Hypermethioninemia with S-adenosylhomocysteine hydrolase deficiency (HMAHCHD) [MIM:613752] 34,294,119(+) CATGG(C/T)CCTGG reference, missense, utr-variant-5-prime
rs121918607 Pathogenic 34,292,467(-) CTGTG(A/G)TGCAT reference, stop-gained, utr-variant-5-prime

Structural Variations from Database of Genomic Variants (DGV) for AHCY Gene

Variant ID Type Subtype PubMed ID
nsv1059756 CNV gain 25217958
nsv1131586 CNV deletion 24896259
nsv3358 CNV deletion 18451855
nsv965872 CNV duplication 23825009

Variation tolerance for AHCY Gene

Residual Variation Intolerance Score: 30.1% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 2.32; 41.34% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for AHCY Gene

Human Gene Mutation Database (HGMD)
AHCY
SNPedia medical, phenotypic, and genealogical associations of SNPs for
AHCY

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for AHCY Gene

Disorders for AHCY Gene

MalaCards: The human disease database

(6) MalaCards diseases for AHCY Gene - From: HGMD, OMIM, ClinVar, GeneTests, Orphanet, Swiss-Prot, DISEASES, Novoseek, and GeneCards

Disorder Aliases PubMed IDs
hypermethioninemia with deficiency of s-adenosylhomocysteine hydrolase
  • hypermethioninemia due to s-adenosylhomocysteine hydrolase deficiency
hypermethioninemia
  • deficiency of methionine adenosyltransferase
adenosine deaminase deficiency
  • ada
immunodeficiency due to purine nucleoside phosphorylase deficiency
  • purine nucleoside phosphorylase deficiency
hyperhomocysteinemia
- elite association - COSMIC cancer census association via MalaCards
Search AHCY in MalaCards View complete list of genes associated with diseases

UniProtKB/Swiss-Prot

SAHH_HUMAN
  • Hypermethioninemia with S-adenosylhomocysteine hydrolase deficiency (HMAHCHD) [MIM:613752]: A metabolic disorder characterized by hypermethioninemia associated with failure to thrive, mental and motor retardation, facial dysmorphism with abnormal hair and teeth, and myocardiopathy. {ECO:0000269 PubMed:15024124, ECO:0000269 PubMed:16736098, ECO:0000269 PubMed:19177456, ECO:0000269 PubMed:20852937}. Note=The disease is caused by mutations affecting the gene represented in this entry.

Relevant External Links for AHCY

Genetic Association Database (GAD)
AHCY
Human Genome Epidemiology (HuGE) Navigator
AHCY
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
AHCY
genes like me logo Genes that share disorders with AHCY: view

No data available for Genatlas for AHCY Gene

Publications for AHCY Gene

  1. Effect of genetic variation in the human S-adenosylhomocysteine hydrolase gene on total homocysteine concentrations and risk of recurrent venous thrombosis. (PMID: 15241484) Gellekink H … Blom HJ (European journal of human genetics : EJHG 2004) 3 4 22 45 60
  2. S-adenosylhomocysteine hydrolase deficiency in a human: a genetic disorder of methionine metabolism. (PMID: 15024124) Baric I … Mudd SH (Proceedings of the National Academy of Sciences of the United States of America 2004) 3 4 22 60
  3. Catalytic strategy of S-adenosyl-L-homocysteine hydrolase: transition-state stabilization and the avoidance of abortive reactions. (PMID: 12590576) Yang X … Schowen RL (Biochemistry 2003) 3 4 22 60
  4. Limited proteolysis of S-adenosylhomocysteine hydrolase: implications for the three-dimensional structure. (PMID: 7786017) Gupta RA … Borchardt RT (Archives of biochemistry and biophysics 1995) 3 4 22 60
  5. Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study. (PMID: 20628086) Bailey SD … DREAM investigators (Diabetes care 2010) 3 45 60

Products for AHCY Gene

  • Addgene plasmids for AHCY

Sources for AHCY Gene

Content
Loading form....