Set Analyses:
Advanced Search

Advanced Search

 
Search By
Section (entire)
for


 
or upload a file of gene symbols


Category   Symbol Source: HGNC EntrezGene Ensembl GeneCards RNA genes CroW21
GIFtS

ADCY6 Gene

protein-coding   GIFtS: 69
GCID: GC12M049159

adenylate cyclase 6

 Explore 12 diseases affiliated with
ADCY6 via our new
 Human Malady Compendium 
Biological research products
for ADCY6
    

(According to 1HGNC, 2Entrez Gene,
3UniProtKB/Swiss-Prot, 4UniProtKB/TrEMBL, 5OMIM, 6GeneLoc, 7Ensembl, 8DME, 9miRBase, and/or 10fRNAdb)
About This Section

Aliases
Adenylate Cyclase 61 2     ATP Pyrophosphate-Lyase 62 3
AC61 2     EC 4.6.1.13 8
Adenylate Cyclase Type VI2 3     Adenylate Cyclase Type 62
Adenylyl Cyclase 62 3     KIAA04223
Ca(2+)-Inhibitable Adenylyl Cyclase2 3     

External Ids:    HGNC: 2371   Entrez Gene: 1122   Ensembl: ENSG000001742337   OMIM: 6002945   UniProtKB: O433063   

Export aliases for ADCY6 gene to outside databases

Previous GC identifers: GC12P061214 GC12M049170 GC12M048876 GC12M047446 GC12M046193


(According to Entrez Gene, Tocris Bioscience, Wikipedia's Gene Wiki, PharmGKB,
UniProtKB/Swiss-Prot, and/or UniProtKB/TrEMBL)
About This Section

Entrez Gene summary for ADCY6:
This gene encodes adenylate cyclase 6, which is a membrane-associated enzyme and catalyzes the formation of the
secondary messenger cyclic adenosine monophosphate (cAMP). The expression of this gene is found in normal thyroid and
brain tissues, as well as some tumors; and its expression is significantly higher in one hyperfunctioning thyroid
tumor than in normal thyroid tissue. Alternative splicing generates 2 transcript variants. (provided by RefSeq, Jul
2008)

UniProtKB/Swiss-Prot: ADCY6_HUMAN, O43306
Function: Membrane-bound, calcium-inhibitable adenylyl cyclase (By similarity)

summary for ADCY6:
Adenylyl Cyclases (AC) are a group of enzymes that convert adenosine-5'-triphosphate (ATP) into
3',5'-adenosine monophosphate (cAMP) and pyrophosphate. There are ten different mammalian isoforms of AC;
nine are membrane-bound, which are all found in, but not limited to, excitable tissues such as neurons and
muscle, and one soluble form (sAC), which is expressed predominantly in the testis. The ten adenylyl cyclase
isoforms can be divided into five distinct families based on their functional attributes; AC1, AC3 and AC8
are Ca2+-calmodulin-sensitive; AC2, AC4 and AC7 are Gbetagamma-stimulatory forms; AC5 and AC6 are
distinguished by their insensitivity to inhibition by both Ca2+ and Galphai; AC9 is forskolin-insensitive
and sAC is similar to cyanobacteria AC. Adenylyl cyclases are regulated by post-translational modifications,
phosphorylation, G proteins, forskolin, pyrophosphate, calcium and calmodulin and the functions of this
enzyme are diverse. Perturbations in adenylyl cyclase activity has been implicated in alcholol and opioid
addiction and is associated with human diseases, including thyroid adenoma, male precocious puberty and
chondrodysplasia.

Gene Wiki entry for ADCY6


(According to GeneLoc and/or HGNC, and/or
Entrez Gene (NCBI build 37),
and/or miRBase,
Genomic Views according to UCSC (hg19) and Ensembl (release 69), Regulatory elements and Epigenetics data according to QIAGEN, SABiosciences, and/or SwitchGear Genomics)
About This Section
RefSeq DNA sequence:
NC_000012.11  NC_018923.1  NT_029419.12  
Regulatory elements:
   SABiosciences Regulatory transcription factor binding sites in the ADCY6 gene promoter:
         MZF-1   Sp1   HNF-1   Pax-2   Pax-2a   HNF-1A   
         Other transcription factors

SwitchGear Promoter luciferase reporter plasmidADCY6 promoter sequence
   Search SABiosciences Chromatin IP Primers for ADCY6

Epigenetics:
QIAGEN PyroMark CpG Assay predesigned Pyrosequencing DNA Methylation assays in human, mouse, rat ADCY6


Genomic Location:
Genomic View: UCSC Golden Path with GeneCards custom track

Entrez Gene cytogenetic band: 12q12-q13   Ensembl cytogenetic band:  12q13.12   HGNC cytogenetic band: 12q12-q13

ADCY6 Gene in genomic location: bands according to Ensembl, locations according to (and/or Entrez Gene and/or Ensembl if different)
ADCY6 gene location

GeneLoc information about chromosome 12         GeneLoc Exon Structure

GeneLoc location for GC12M049159:  view genomic region     (about GC identifiers)

Start:
49,159,975 bp from pter      End:
49,182,820 bp from pter
Size:
22,846 bases      Orientation:
minus strand

(According to 1UniProtKB, HORDE, neXtProt, Ensembl, and/or Reactome, Modification sites according to 2PhosphoSitePlus, Specific Peptides from DME, Protein expression images according to data from SPIRE MOPED and PaxDb, RefSeq according to NCBI, PDB rendering according to OCA and/or Proteopedia, Recombinant Proteins from EMD Millipore, R&D Systems, GenScript, Enzo Life Sciences, OriGene, Novus Biologicals, Sino Biological, ProSpec, and/or Uscn,
Biochemical Assays by EMD Millipore, R&D Systems, OriGene, GenScript, Cell Signaling Technology, Enzo Life Sciences, and/or Uscn, Ontologies according to Gene Ontology Consortium 01 Mar 2013 and Entrez Gene, Antibodies by EMD Millipore, R&D Systems, GenScript, Cell Signaling Technology, OriGene, Novus Biologicals, Thermo Fisher Scientific, Abcam, and/or Uscn)
About This Section

UniProtKB/Swiss-Prot: ADCY6_HUMAN, O43306 (See protein sequence)
Recommended Name: Adenylate cyclase type 6  
Size: 1168 amino acids; 130615 Da
Cofactor: Binds 2 magnesium ions per subunit (By similarity)
Subunit: Part of a complex containing AKAP5, ADCY5, PDE4C and PKD2 (By similarity). Interacts with RAF1
Subcellular location: Membrane; Multi-pass membrane protein. Cell projection, cilium (By similarity)
Sequence caution: Sequence=BAA24852.2; Type=Erroneous initiation;
Secondary accessions: Q9NR75 Q9UDB0
Alternative splicing: 2 isoforms:  O43306-1   O43306-2   (No experimental confirmation available)

Explore the universe of human proteins at neXtProt for ADCY6: NX_O43306

Post-translational modifications:

  • Phosphorylated by RAF11
  • View modification sites using PhosphoSitePlus2
  • View neXtProt modification sites for NX_O43306

  • 35 DME Specific Peptides for ADCY6 (O43306) (see first 4)
     AGRIHIT  EKIKTIG  FHKIYIQ  IETFLIL 
     DLEKKYS  RLDFLWK  QQERLLLS  MRVGIHSG 
     TYFLNGGP  SRMDSTGV  ERLLLSVLP  RMRAAVLSG 
     PTCSFPEYF  TYMAASGLN  RAIDARSID  RFGAYVACA 
     LERLYQRYF  HVRRFLLTF  DVTLANHME  AGVIGARKP 
     QKRKEEKAM  NPEDEVDEFL  LNGDYEVEPG  DHAHCCVEMG 
     ECLRLLNEII  LASQCTAQELV  RIKILGDCYYC  LNEIIADFDEIISE 
     CGVLGLRKWQFDVWS  YQLECRGVVKVKGKGEM  CTHYPAEVSQRQAFQETR  LMVVCNRHSFRQDSMWVVSYVVLGILAAVQVGGALAA 
     EKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDEL  GRSHITALADYAMRLMEQMKHINEHSFNNFQMKIGLNMGP  KLQRTRANSMEGLMPRWVPDRAFSRTKDSKAFRQMGIDDS 

    ADCY6 Protein expression data from MOPED and PaxDb:    About this image 
    Estimated protein expression log10 (pmol).

    REFSEQ proteins (2 alternative transcripts): 
    NP_056085.1  NP_066193.1  

    ENSEMBL proteins: 
     ENSP00000446730   ENSP00000311405   ENSP00000447702   ENSP00000350536  
    Reactome Protein details: O43306
    Human Recombinant Protein Products: 
    Browse Purified and Recombinant Proteins at EMD Millipore
    Browse R&D Systems for human recombinant proteins
    Browse recombinant and purified proteins available from Enzo Life Sciences
    Browse OriGene full length recombinant human proteins expressed in human HEK293 cells
    Browse OriGene Protein Over-expression Lysates
    OriGene Custom Protein Services for ADCY6 
    GenScript Custom Purified and Recombinant Proteins Services for ADCY6
    Novus Biologicals ADCY6 Protein
    Browse Sino Biological Recombinant Proteins
    Browse ProSpec Recombinant Proteins
    Uscn Proteins for ADCY6

    Gene Ontology (GO): 5/10 cellular component terms (GO ID links to tree view) (see all 10):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0005624membrane fraction ----
    GO:0005768endosome ----
    GO:0005886plasma membrane TAS--
    GO:0005929cilium IEA--
    GO:0016020membrane ISS--


    ADCY6 for ontologies           About GeneDecksing



    ADCY6 Antibody Products: 
    Browse EMD Millipore's Extensive Line of Mono- and Polyclonal Antibodies
    Browse R&D Systems for Antibodies
    OriGene Antibodies: ADCY6
    OriGene Custom Antibody Services for ADCY6 
    GenScript Custom Superior Antibodies Services for ADCY6
    Novus Biologicals ADCY6 Antibodies
    Search for Antibodies for ADCY6 at Abcam  
    Uscn Antibodies for ADCY6
    ThermoFisher Antibodies for ADCY6

    Assay Products for ADCY6: 
    Browse Kits and Assays available from EMD Millipore
    OriGene Custom Immunoassay Development
    Browse OriGene Fluorogenic Cell Assay Kits
    Browse R&D Systems for biochemical assays
    GenScript Custom Assay Services for ADCY6
    Browse Enzo Life Sciences for kits & assays
    Uscn ELISAs and CLIAs for ADCY6


    (According to InterPro, ProtoNet, UniProtKB, and/or BLOCKS, Sets of similar genes according to GeneDecks)
    About This Section

    ADCY6 for domains           About GeneDecksing

    3 InterPro domains/families:
     IPR009398 Adenylate_cyclase-like
     IPR001054 A/G_cyclase
     IPR018297 A/G_cyclase_CS

    Graphical View of Domain Structure for InterPro Entry O43306

    ProtoNet protein and cluster: O43306

    1 Blocks protein family: IPB009398 Adenylate cyclase-like

    UniProtKB/Swiss-Prot: ADCY6_HUMAN, O43306
    Similarity: Belongs to the adenylyl cyclase class-4/guanylyl cyclase family
    Similarity: Contains 2 guanylate cyclase domains


    (According to 1UniProtKB, Genatlas, LifeMap Discovery™, IUBMB, and/or 2DME, Human phenotypes from GenomeRNAi, Animal models from MGI Mar 06 2013,
    bound targets from SABiosciences, miRNA Gene Targets from miRTarBase shRNA from OriGene, RNAi from EMD Millipore, siRNAs from OriGene, QIAGEN, microRNA from QIAGEN, Gene Editing from DNA2.0, Clones from EMD Millipore, OriGene, SwitchGear Genomics, GenScript, Sino Biological, DNA2.0, and Vector BioLabs, Cell Lines from GenScript, LifeMap BioReagents, In Situ Hybridization Assays from Advanced Cell Diagnostics, Ontologies according to Gene Ontology Consortium 01 Mar 2013 via Entrez Gene.)
    About This Section

    Function Summary:

         UniProtKB/Swiss-Prot: ADCY6_HUMAN, O43306
    Function: Membrane-bound, calcium-inhibitable adenylyl cyclase (By similarity)
    Catalytic activity: ATP = 3',5'-cyclic AMP + diphosphate
    Enzyme regulation: Inhibition by calcium in the submicromolar concentration range (By similarity). Phosphorylation by
    RAF1 results in its activation

         Genatlas biochemistry entry for ADCY6:
    adenylyl cyclase,type VI,ubiquitous

    Enzyme Number (IUBMB): EC 4.6.1.11 2

    miRNA
    Products:
        
    miRTarBase miRNAs that target ADCY6:
    hsa-mir-182 (MIRT001992)

    OriGene 3'-UTR Clone (see all 2): ADCY6
    Browse MicroRNA Expression Plasmids
    QIAGEN Custom miScript Target Protector blocks miRNA-binding site of human, mouse, rat ADCY6
    8/69 QIAGEN miScript miRNA Assays for microRNAs that regulate ADCY6 (see all 69):
    hsa-miR-140-5p hsa-miR-323-3p hsa-miR-4254 hsa-miR-631 hsa-miR-1224-3p hsa-miR-128 hsa-miR-3138 hsa-miR-138-2*
    SwitchGear 3'UTR luciferase reporter plasmidADCY6 3' UTR sequence
    Inhib. RNA
    Products:
        
    Browse for Gene Knock-down Tools from EMD Millipore
    OriGene 29mer shRNA kits in GFP-retroviral vector in human, mouse, rat for ADCY6 (see all 7)
    OriGene shRNA RFP: ADCY6
    OriGene siRNA: ADCY6
    QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat ADCY6

    Gene Editing
    Products:
    DNA2.0 Custom Protein Engineering Service for ADCY6

    Clone
    Products:
         
    Browse Clones for the Expression of Recombinant Proteins Available from EMD Millipore
    OriGene Myc/DDK tagged cDNA clones in CMV expression vector in human, mouse, rat for ADCY6 (see all 4)
    OriGene untagged cDNA clones in CMV expression vector in human, mouse, rat for ADCY6 (see all 2)
    OriGene custom cloning services – gene synthesis, subcloning, mutagenesis, variant library, vector shuttling 
    GenScript: all cDNA clones in your preferred vector (see all 2): ADCY6 (NM_020983)
    Browse Sino Biological Human cDNA Clones
    DNA2.0 Custom Codon Optimized Gene Synthesis Service for ADCY6
    Search Vector BioLabs for ready-to-use adenovirus/AAV for human, mouse, rat ADCY6 

    Cell Line
    Products:
         
    GenScript Custom overexpressing Cell Line Services for ADCY6
    Search LifeMap BioReagents cell lines for ADCY6

    In Situ Assay
    Products:
       

     
    Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for ADCY6

    Gene Ontology (GO): 5/7 molecular function terms (GO ID links to tree view) (see all 7):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0004016adenylate cyclase activity IDA18403039
    GO:0005102receptor binding ----
    GO:0005515protein binding IPI17081159
    GO:0005524ATP binding IEA--
    GO:0008294calcium- and calmodulin-responsive adenylate cyclase activity ----


    ADCY6 for ontologies           About GeneDecksing


    2 GenomeRNAi human phenotypes for ADCY6:
     G0/1 arrest  Increased G1 DNA content 

    Animal Models:
         Mouse knock-outs for ADCY6: Adcy6tm2Yich Adcy6tm1Hkh
         5 MGI mutant phenotypes (inferred from 3 alleles(MGI details for Adcy6):
     behavior/neurological  cardiovascular system  homeostasis/metabolism  muscle  renal/urinary system 

    ADCY6 for phenotypes           About GeneDecksing


    (Pathways according to EMD Millipore, R&D Systems, Cell Signaling Technology, KEGG, PharmGKB, BioSystems, Reactome, Tocris Bioscience, GeneGo (Thomson Reuters), QIAGEN, and/or UniProtKB, Sets of similar genes according to GeneDecks, Interaction Networks according to SABiosciences, and/or STRING, Interactions according to 1UniProtKB, 2MINT, 3I2D, and/or 4STRING, with links to IntAct and Ensembl, Ontologies according to Gene Ontology Consortium 01 Mar 2013 via Entrez Gene).
    About This Section

    Unified GeneCards pathways - 5/53 super-pathways (see all 53About this table 
    See pathways by source

    Super-pathwaycontained gene-specific pathways
    1Signaling by FGFR
    8/12 pathways (see all 12)
    Signaling by FGFR1.00
    DAP12 signaling0.83
    Downstream signaling of activated FGFR0.92
    Signaling by EGFR in Cancer0.83
    Signaling by FGFR in disease0.91
    DAP12 interactions0.76
    Signaling by ERBB20.89
    Signaling by PDGF0.72
    2PKA activation in glucagon signalling
    8/12 pathways (see all 12)
    PKA activation in glucagon signalling1.00
    Neurophysiological process_PGE2-induced pain processing0.44
    PKA activation0.94
    Inhibitory action of Lipoxin A4 on PDGF, EGF and LTD4 signaling0.37
    PKA-mediated phosphorylation of CREB0.89
    Development_Role of Activin A in cell differentiation and proliferation0.33
    Regulation of CFTR gating (normal and CF)0.76
    Development Role of Activin A in cell differentiation and proliferation0.33
    3DAG and IP3 signaling
    DAG and IP3 signaling1.00
    CaM pathway0.84
    PLC-gamma1 signalling0.94
    Calmodulin induced events0.84
    EGFR interacts with phospholipase C-gamma0.94
    Ca-dependent events0.79
    PLCG1 events in ERBB2 signaling0.91
    Phospholipase C-mediated cascade0.57
    4Regulation of Water Balance by Renal Aquaporins
    Regulation of Water Balance by Renal Aquaporins1.00
    G alpha (z) signalling events0.48
    Aquaporin-mediated transport0.84
    Cytoskeleton remodeling_Role of PKA in cytoskeleton reorganisation0.40
    Glucagon signaling in metabolic regulation0.69
    Cytoskeleton remodeling Role of PKA in cytoskeleton reorganisation0.40
    5Opioid Signalling
    Opioid Signalling1.00
    Beta-agonist/Beta-blocker Pathway, Pharmacodynamics0.35
    G-protein mediated events0.55
    Glutamatergic synapse0.31
    PLC beta mediated events0.54

    Pathway sources
    See GeneCards unified pathways
    Show all pathways

    5/10 EMD Millipore Pathways for ADCY6 (see all 10)
        Adenylate cyclase-activating neuropeptides
    Cytoskeleton remodeling Role of PKA in cytoskeleton reorganisation
    Development Beta-adrenergic receptors signaling via cAMP
    Development A2A receptor signaling
    Signal transduction cAMP signaling

    5/23 Downloadable PowerPoint Slides of QIAGEN Pathway Central Maps for ADCY6 (see all 23)
        MAPK Signaling
    PKA Signaling
    Molecular Mechanisms of Cancer
    Relaxin Pathway
    G-AlphaI Signaling

    5/13 GeneGo (Thomson Reuters) Pathways for ADCY6 (see all 13)
        Development A2A receptor signaling
    Development Beta-adrenergic receptors signaling via cAMP
    Signal transduction cAMP signaling
    Signal transduction PKA signaling
    Development Endothelin-1/EDNRA signaling

    5/6 BioSystems Pathways for ADCY6 (see all 6
        Calcium Regulation in the Cardiac Cell
    G Protein Signaling Pathways
    Myometrial Relaxation and Contraction Pathways
    Endothelins
    LPA receptor mediated events

    5/53        Reactome Pathways for ADCY6 (see all 53)
        PKA activation
    Signaling by EGFR in Cancer
    G alpha (z) signalling events
    Downstream signal transduction
    Signal Transduction

    2 PharmGKB Pathways for ADCY6
        Beta-agonist/Beta-blocker Pathway, Pharmacodynamics
    Proton Pump Inhibitor Pathway, Pharmacodynamics

    5/18         Kegg Pathways  (Kegg details for ADCY6) (see all 18):
        Purine metabolism
    Chemokine signaling pathway
    Oocyte meiosis
    Vascular smooth muscle contraction
    Gap junction


    ADCY6 for pathways           About GeneDecksing

    Interactions:

        Search SABiosciences Gene Network CentralTM Interacting Genes and Proteins Networks for ADCY6

    STRING Interaction Network Preview (showing 5 interactants - click image to see 25)

    5/298 Interacting proteins for ADCY6 (O433062, 3 ENSP000003114054) via UniProtKB, MINT, STRING, and/or I2D (see all 298)
    InteractantInteraction Details
    GeneCardExternal ID(s)
    ATXN1P542532, 3, ENSP000002447694MINT-2856791 I2D: score=3 STRING: ENSP00000244769
    GNASQ5JWF23, ENSP000003601414I2D: score=3 STRING: ENSP00000360141
    CHRNA7P365443, ENSP000003037274I2D: score=2 STRING: ENSP00000303727
    RAF1P040493, ENSP000002518494I2D: score=2 STRING: ENSP00000251849
    ADCY1ENSP000002973234STRING: ENSP00000297323
    About this table

    Gene Ontology (GO): 5/19 biological process terms (GO ID links to tree view) (see all 19):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0006112energy reserve metabolic process TAS--
    GO:0006171cAMP biosynthetic process IDA18403039
    GO:0006833water transport TAS--
    GO:0007165signal transduction TAS--
    GO:0007173epidermal growth factor receptor signaling pathway TAS--


    ADCY6 for ontologies           About GeneDecksing



    (Chemical Compounds according to UniProtKB, Enzo Life Sciences, EMD Millipore, Tocris Bioscience HMDB, BitterDB, and/or Novoseek, and Drugs according to DrugBank, Enzo Life Sciences, and/or PharmGKB, with drugs/clinical trials/news search links to CenterWatch)
    About This Section

    ADCY6 for compounds           About GeneDecksing

    EMD Millipore small molecules for ADCY6:
    Small Molecule - inhibitor
    Browse drugs & compounds from Enzo Life Sciences

    Compounds for ADCY6 available from Tocris Bioscience    About this table
    CompoundAction CAS #
    BPIPPNon-competitive GC inhibitor. Also AC inhibitor[325746-94-9]
    NKH 477Water-soluble adenylyl cyclase activator[138605-00-2]
    ForskolinAdenylyl cyclase activator[66575-29-9]
    SQ 22536Adenylyl cyclase inhibitor[17318-31-9]
    PACAP 1-38Potent stimulator of adenylyl cyclase--

    10/11 HMDB Compounds for ADCY6 (see all 11)    About this table
    CompoundSynonyms CAS #PubMed Ids
    Adenosine triphosphate5'-(tetrahydrogen triphosphate) Adenosine (see all 24)56-65-5--
    CalciumCa (see all 2)7440-70-2--
    Cyclic AMPCyclic AMP (see all 19)60-92-4--
    Cyclic GMP3',5'-cyclic GMP (see all 13)7665-99-8--
    Guanosine triphosphate5'-GTP (see all 10)86-01-1--
    MagnesiumMagnesium (see all 2)7439-95-4--
    NAD3-Carbamoyl-1-D-ribofuranosylpyridinium hydroxide 5'-ester with adenosine 5'-pyrophosphate (see all 28)53-84-9--
    NADH1,4-Dihydronicotinamide adenine dinucleotide (see all 17)58-68-4--
    Phosphoric acidacide phosphorique (FRENCH) (see all 20)7664-38-2--
    Pyrophosphate(4-)Diphosphoric acid ion (see all 10)14000-31-8--
    2 Novoseek chemical compound relationships for ADCY6 gene    About this table
    Compound   -log (P-Val)   Hits   PubMed IDs for Articles with Shared Sentences (# sentences)
    adenylate 64.5 6 15683739 (2), 9841634 (1), 15225617 (1), 15885660 (1) (see all 5)
    dopamine 25.6 1 15683739 (1)

    Search CenterWatch for drugs/clinical trials and news about ADCY6 

    (Secondary structures according to fRNAdb,
    GenBank/EMBL/DDBJ Accessions according to
    Unigene (Build 235 Homo sapiens; Mar 10 2013) or GenBank,
    RefSeq according to Entrez Gene,
    DOTS (version 10), and/or AceView, transcript ids from Ensembl with links to UCSC,
    exon structure from GeneLoc, alternative splicing isoforms according to ASD and/or ECgene,
    RNAi Products from EMD Millipore,
    siRNAs from OriGene, QIAGEN, shRNA from OriGene, microRNA from QIAGEN,
    Tagged/untagged cDNA clones from OriGene, SwitchGear Genomics, GenScript, DNA2.0, Vector BioLabs, Primers from OriGene, SABiosciences, and/or QIAGEN )
    About This Section

    REFSEQ mRNAs for ADCY6 gene (2 alternative transcripts): 
    NM_015270.3  NM_020983.2  

    Unigene Clusters for ADCY6:

    Adenylate cyclase 6
    Hs.525401  [show with all ESTs], Hs.694408  [show with all ESTs]
    Unigene Representative Sequences: NM_015270, AK225224
    9 Ensembl transcripts including schematic representations, and UCSC links where relevant:
    ENST00000547260(uc010slw.1) ENST00000550422(uc001rsi.4 uc001rsj.4)
    ENST00000307885(uc001rsh.4) ENST00000552099 ENST00000548351 ENST00000552090
    ENST00000551435 ENST00000548820 ENST00000357869

    miRNA
    Products:
         
    OriGene 3'-UTR Clone (see all 2): ADCY6
    Browse OriGene MicroRNA Expression Plasmids
    QIAGEN Custom miScript Target Protector blocks miRNA-binding site of human, mouse, rat ADCY6
    8/69 QIAGEN miScript miRNA Assays for microRNAs that regulate ADCY6 (see all 69):
    hsa-miR-140-5p hsa-miR-323-3p hsa-miR-4254 hsa-miR-631 hsa-miR-1224-3p hsa-miR-128 hsa-miR-3138 hsa-miR-138-2*
    SwitchGear 3'UTR luciferase reporter plasmidADCY6 3' UTR sequence
    Inhib. RNA
    Products:
         
    Browse for Gene Knock-down Tools from EMD Millipore
    OriGene 29mer shRNA kits in GFP-retroviral vector in human, mouse, rat for ADCY6 (see all 7)
    OriGene shRNA RFP: ADCY6
    OriGene siRNA: ADCY6
    QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat ADCY6
    Clone
    Products:
         
    OriGene Myc/DDK tagged cDNA clones in CMV expression vector in human, mouse, rat for ADCY6 (see all 4)
    OriGene untagged cDNA clones in CMV expression vector in human, mouse, rat for ADCY6 (see all 2)
    OriGene custom cloning services – gene synthesis, subcloning, mutagenesis, variant library, vector shuttling 
    GenScript: all cDNA clones in your preferred vector (see all 2): ADCY6 (NM_020983)
    DNA2.0 Custom Codon Optimized Gene Synthesis Service for ADCY6
    Search Vector BioLabs for ready-to-use adenovirus/AAV for human, mouse, rat ADCY6 
    Primer
    Products:
        
    OriGene genome-wide validated SYBR primer pairs in human, mouse, rat for ADCY6
    Browse OriGene validated miRNA SYBR primer pairs
    SABiosciences RT2 qPCR Primer Assay in human, mouse, rat ADCY6
      QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat ADCY6
      QIAGEN QuantiFast Probe-based Assays in human, mouse, rat ADCY6

    Additional cDNA sequence: AK225224.1 

    11 DOTS entries:

    DT.99937161  DT.40108164  DT.91743387  DT.453565  DT.95333624  DT.100777803  DT.100730796  DT.100027161 
    DT.100777796  DT.102831861  DT.75111797 

    7 AceView cDNA sequences:

    U65474 AB007882 BX537664 NM_020983 NM_015270 AF250226 BC064923 

    GeneLoc Exon Structure

    3 Alternative Splicing Database (ASD) splice patterns (SP) for ADCY6    About this scheme

    ExUns: 1 ^ 2 ^ 3 ^ 4 ^ 5 ^ 6 ^ 7a · 7b ^ 8 ^ 9 ^ 10 ^ 11 ^ 12 ^ 13 ^ 14 ^ 15 ^ 16 ^ 17 ^ 18 ^ 19 ^ 20 ^ 21
    SP1:                                                                                                                                    
    SP2:                                                                                      -                                             
    SP3:                                                                                                                                    


    ECgene alternative splicing isoforms for ADCY6

    (RNA expression data according to H-InvDB, NONCODE, miRBase, and RNAdb, Expression images according to data from BioGPS, Illumina Human BodyMap, and CGAP SAGE, Sets of similar genes according to GeneDecks, in vivo and in vitro expression data from LifeMap Discovery™, plus additional links to Genevestigator, and/or SOURCE, and/or BioGPS, and/or UniProtKB,
    PCR Arrays from SABiosciences, Primers from OriGene, SABiosciences, and/or QIAGEN, In Situ Hybridization Assays from Advanced Cell Diagnostics)
    About This Section

    ADCY6 expression in normal human tissues (normalized intensities)
    See probesets specificity/sensitivity at GeneAnnot
    About this imageBioGPS
    CGAP TAG: GAGATGAAAG

    Microarray
    RNAseq (Illumina Body Map)
    (100×FPKM)½
    SAGE (Serial Analysis of Gene Expression)

    About this image
    See ADCY6 Protein Expression from SPIRE MOPED and PaxDB
    Genevestigator expression for ADCY6

    SOURCE GeneReport for Unigene clusters: Hs.525401 Hs.694408
        SABiosciences Custom PCR Arrays for ADCY6
    Primer
    Products:
    OriGene genome-wide validated SYBR primer pairs in human, mouse, rat for ADCY6
    Browse OriGene validated miRNA SYBR primer pairs
    SABiosciences RT2 qPCR Primer Assay in human, mouse, rat ADCY6
    QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat ADCY6
    QIAGEN QuantiFast Probe-based Assays in human, mouse, rat ADCY6
    In Situ
    Assay Products:
     

     
    Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for ADCY6

    (Orthologs according to 1,2HomoloGene (2older version, for species not in 1newer version), 3euGenes, 4SGD , 5MGI Mar 06 2013, with possible further links to Flybase and/or WormBase, and/or 6Ensembl pan taxonomic compara , Gene Trees according to Ensembl and TreeFam)
    About This Section

    This gene was present in the common ancestor of animals.

    Orthologs for ADCY6 gene from 4/21 species (see all 21)    About this table
    Organism Taxonomic
    classification
    Gene Description Human
    Similarity
    Orthology
    Type
    Details
    lizard
    (Anolis carolinensis)
    Reptilia ADCY66
    --
    77(a)
    1 ↔ 1
    2(94460752-94526698)
    zebrafish
    (Danio rerio)
    Actinopterygii adcy6b1 adenylate cyclase 6b 70.88(n)
    74.89(a)
      560807  XM_002666490.1  XP_002666536.1 
    fruit fly
    (Drosophila melanogaster)
    Insecta rut3 molting cycle (sensu Insecta) adenylate
    cyclase
    49(a)
    (best of 5)
      12F4   --
    worm
    (Caenorhabditis elegans)
    Secernentea acy-43   -- 49(a)
    (best of 2)
      V(5627531-5629064)   --


    ENSEMBL Gene Tree for ADCY6 (if available)
    TreeFam Gene Tree for ADCY6 (if available) 

    (Paralogs according to 1HomoloGene,
    2Ensembl, and 3SIMAP, Pseudogenes according to 4Pseudogene.org Build 68)
    About This Section
    Paralogs for ADCY6 gene
    ADCY52  ADCY22  GUCY2D2  GUCY2C2  NPR12  ADCY82  GUCY2F2  GUCY1A22  
    ADCY72  ADCY92  GUCY1B32  GUCY1A32  ADCY12  ADCY42  NPR22  ADCY32  
    7 SIMAP similar genes for ADCY6 using alignment to 2 protein entries:     ADCY6_HUMAN (see all proteins):
    ADCY5    ADCY1    ADCY3    ADCY2    ADCY4    ADCY8
    ADCY7

    ADCY6 for paralogs           About GeneDecksing



    (SNPs/Variants according to the 1NCBI SNP Database, 2Ensembl, 3PupaSUITE, UniProtKB, and DNA2.0, Linkage Disequilibrium by HapMap, Structural Variations(CNVs/InDels/Inversions) from the Database of Genomic Variants, Mutations from the Human Gene Mutation Database (HGMD) and the Locus Specific Mutation Databases (LSDB), Blood group antigen gene mutations by BGMUT, Resequencing Primers from QIAGEN, Cancer Mutation PCR Arrays and Assays and Copy Number PCR Arrays from SABiosciences)
    About This Section

    10/430 NCBI SNPs in ADCY6 are shown (see all 430    About this table
    Genomic DataTranscription Related DataAllele Frequencies
    SNP IDValidClinical
    significance
    Chr 12 posSequence#AA
    Chg
    TypeMore#Allele
    freq
    PopTotal
    sample
    More
    ----------
    rs617388491,2
    C,F,--46213184(+) AGCTAG/CCAGCA 1 -- us2k13Minor allele frequency- C:0.46NS WA 196
    rs778499571,2
    C,F,--46215085(+) CAGGGG/TATTAA 2 -- us2k11Minor allele frequency- T:0.09WA 118
    rs1139641661,2
    --46215156(+) CACCAC/GCCACC 2 -- us2k12Minor allele frequency- G:0.10CSA WA 119
    rs775592881,2
    F,--46216485(+) CTCTCC/GCGCCC 2 -- int1 us2k12Minor allele frequency- G:0.16WA NA 238
    rs111687421,2
    C,F,A,H,--46217355(+) CCTAGG/ATATCT 2 -- int118Minor allele frequency- A:0.14NS EA NA WA CSA 2221
    rs758753541,2
    --46217395(+) CCCTGC/AAGTCC 2 -- nc-transcript-variant1Minor allele frequency- A:0.01WA 118
    rs1417675961,2
    --49159514(+) AGTTCC/TGATGG 4 -- ds5001 nc-transcript-variant0--------
    rs1169579371,2
    C,F,--49159535(+) GGAGGA/CGGAGA 4 -- nc-transcript-variantds50011Minor allele frequency- C:0.07EA 120
    rs71321801,2
    C,F,A,H,--49159610(+) TCAGGA/GTGGGA 4 -- ds500118Minor allele frequency- G:0.22NS EA NA WA CSA 2223
    rs1906936821,2
    --49160383(+) TTTCCC/TCTCCT 2 -- ut310--------

    HapMap Linkage Disequilibrium report for ADCY6 (49159975 - 49182820 bp)
    Structural Variations (Copy Number Variations, Insertions/Deletions, Inversions)
          Database of Genomic Variants (DGV) variations for ADCY6: --
    Human Gene Mutation Database (HGMD): ADCY6

    SABiosciences Cancer Mutation PCR Assays
    QIAGEN SeqTarget long-range PCR primers in human, mouse, rat for resequencing ADCY6
    DNA2.0 Custom Variant and Variant Library Synthesis for ADCY6

    (in which this Gene is Involved, According to MalaCards, OMIM, UniProtKB, the University of Copenhagen DISEASES database, Genatlas, GeneTests, GAD, HuGE Navigator, and/or TGDB.)
    About This Section

    ADCY6 for disorders           About GeneDecksing

    OMIM gene information: 600294    OMIM disorders: --

    12 diseases for ADCY6:    About MalaCards
    precocious puberty    thyroid adenoma    thyroiditis    chondrodysplasia
    adenoma    neuronitis    cholera    ataxia
    immunodeficiency    pancreatitis    colorectal cancer    breast cancer

    1 disease from the University of Copenhagen DISEASES database for ADCY6:
    Cholera
    Genetic Association Database (GAD): ADCY6
    Human Genome Epidemiology (HuGE) Navigator: ADCY6 (3 documents)

    Export disorders for ADCY6 gene to outside databases

    (in PubMed. Associations of this gene to articles via 1Entrez Gene, 2UniProtKB/Swiss-Prot, 3HGNC, 4GAD, 5PharmGKB, 6HMDB, 7DrugBank, 8UniProtKB/TrEMBL, 9 Novoseek, and/or 10fRNAdb)
    About This Section

    PubMed articles for ADCY6 gene, integrated from 9 sources (see all 58):
    (articles sorted by number of sources associating them with ADCY6)
        Utopia: connect your pdf to the dynamic
    world of online information

    1. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PubMed id 15489334)1, 2 Gerhard D.S....Malek J. (2004)
    2. Polymorphism of the type 6 adenylyl cyclase gene and cardiac hypertrophy. (PubMed id 14871025)1, 4 Ikoma E....Ishikawa Y. (2003)
    3. Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones. (PubMed id 12168954)1, 2 Nakajima D.... Nagase T. (2002)
    4. Cloning and expression of human adenylyl cyclase type VI in normal thyroid tissues. (PubMed id 10978539)1, 2 Wicker R.... Suarez H.G. (2000)
    5. Prediction of the coding sequences of unidentified human genes. VIII. 78 new cDNA clones from brain which code for large proteins in vitro. (PubMed id 9455477)1, 2 Ishikawa K....Ohara O. (1997)
    6. A proteome-wide, quantitative survey of in vivo ubiqui tylation sites reveals widespread regulatory roles. (PubMed id 21890473)1 Wagner S.A....Choudhary C. (2011)
    7. Mass spectrometric analysis of lysine ubiquitylation r eveals promiscuity at site level. (PubMed id 21139048)1 Danielsen J.M....Nielsen M.L. (2011)
    8. Human bronchial smooth muscle cells express adenylyl cyclase isoforms 2, 4, and 6 in distinct membrane microdomains. (PubMed id 21228062)1 Bogard A.S....Ostrom R.S. (2011)
    9. PPARgamma-dependent regulation of adenylate cyclase 6 amplifies the stimulatory effect of cAMP on renin gene expression. (PubMed id 20861226)1 Desch M....Todorov V.T. (2010)
    10. Increased blood pressure and hyperdynamic cardiovascu lar responses in carriers of a common hyperfunctional variant of adenylyl cycla se 6. (PubMed id 20732959)1 Hodges G.J....Feldman R.D. (2010)

    (in PubMed, OMIM, and NCBI Bookshelf)
    About This Section
     ANDOR
    Aliases
    Free Text  

      Query String
    PubMed
    OMIM
    NCBI Bookshelf
      (Note: In FireFox, select the above section and copy using Ctrl-C)

    (According to Entrez Gene, HGNC, AceView, euGenes, Ensembl, miRBase, ECgene, Kegg, and/or H-InvDB)
    About This Section
    Entrez Gene: 112 HGNC: 237 AceView: ADCY6 Ensembl:ENSG00000174233 euGenes: HUgn112
    ECgene: ADCY6 Kegg: 112 H-InvDB: ADCY6

    (According to HUGE)
    About This Section
    HUGE: KIAA0422

    (According to PharmGKB, ATLAS, HORDE, IMGT, LEIDEN, UniProtKB/Swiss-Prot, and/or UniProtKB/TrEMBL,
    Wikipedia and/or GeneReviews via UniProtKB/Swiss-Prot)
    About This Section
    NameDescription
    PharmGKB entry for ADCY6 Pharmacogenomics, SNPs, Pathways
    ATLAS Chromosomes in Cancer entry for ADCY6 Genetics and Cytogenetics in Oncology and Haematology

    (Patent information from GeneIP,
    Licensable technologies from WIS Yeda, Salk, Tufts,
    IP news from LifeMap Sciences, Inc.)
    About This Section
    Patent Information for ADCY6 gene:
    Search GeneIP for patents involving ADCY6

    GeneCards and IP:
    Japan Patent Office Licenses GeneCards     European Patent Office Licenses GeneCards     Improving the IP Search



    (Antibodies, recombinant proteins, and assays from EMD Millipore, R&D Systems, OriGene, QIAGEN, GenScript, Cell Signaling Technology, SABiosciences, Novus Biologicals, Sino Biological, Enzo Life Sciences, Abcam, ProSpec, Uscn, Thermo Fisher Scientific, Gene Editing from DNA2.0, Clones from EMD Millipore, OriGene, GenScript, Sino Biological, DNA2.0, SwitchGear Genomics, Vector BioLabs, Cell lines from GenScript and LifeMap BioReagents, PCR Arrays from SABiosciences, Drugs and/or compounds from EMD Millipore, Tocris Bioscience, and/or Enzo Life Sciences),
    In Situ Hybridization Assays from
    Advanced Cell Diagnostics
    About This Section

     Browse Kits and Assays available from EMD Millipore
     Browse Purified and Recombinant Proteins at EMD Millipore
     Browse EMD Millipore's Extensive Line of Mono- and Polyclonal Antibodies
     Browse Clones for the Expression of Recombinant Proteins Available from EMD Millipore
     EMD Millipore small molecules (inhibitor) for ADCY6
     Browse for Gene Knock-down Tools from EMD Millipore
     
     EMD Millipore Custom Antibody & Bulk Services
     EMD Millipore Preclinical / Clinical Development Services
     EMD Millipore Immunoassay Services
     EMD Millipore Target Screening & Profiling Services

      
     Browse Antibodies   Browse Cell Culture Products  
     Browse ELISAs   Browse Flow Cytometry Kits  
     Browse Primer Pairs   Browse Kinase Activity Assays/Reagents  
     Browse ELISpot Kits/Development Modules   Browse TFB/Immunoprecipitation Assays  
     Browse Apoptosis Detection Kits/Reagents   Browse Ubiquitin Proteasome Pathway (UPP) Assay Kits/Reagents  
     Browse DNA Damage/Repair Kits/Reagents   Browse Multiplex/Array Assay Kits/Reagents  
     Browse Cell Selection/Detection Kits/Reagents   Browse Secondary Antibodies/Controls/Staining Reagents  
     Browse Phosphatase Activity Assays/Reagents   Browse Recombinant/Natural Proteins  
     OriGene Antibodies for ADCY6   OriGene shRNA RFP for ADCY6  
     OriGene 29mer shRNA kits in GFP-retroviral vector in human, mouse, rat for ADCY6   OriGene genome-wide validated SYBR primer pairs in human, mouse, rat for ADCY6  
     Browse OriGene Protein Over-expression Lysates   Browse OriGene Fluorogenic Cell Assay Kits  
     OriGene siRNA for ADCY6   OriGene 3'-UTR Clone for ADCY6  
     OriGene untagged cDNA clones in CMV expression vector in human, mouse, rat for ADCY6   OriGene Myc/DDK tagged cDNA clones in CMV expression vector in human, mouse, rat for ADCY6  
     Browse OriGene GFP tagged cDNA clones in CMV expression vector   Browse OriGene MicroRNA Expression Plasmids  
     Browse OriGene basic RS shRNAs   Browse OriGene validated miRNA SYBR primer pairs  
     Browse OriGene full length recombinant human proteins expressed in human HEK293 cells   OriGene custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling  
     OriGene Custom Antibody Services for ADCY6   OriGene Custom Protein Services for ADCY6  
     OriGene Custom Immunoassay Development  

     
     
     QIAGEN Custom miScript Target Protector blocks miRNA-binding site of in human, mouse, rat ADCY6
     QIAGEN SeqTarget long-range PCR primers in human, mouse, rat for resequencing ADCY6
     QIAGEN PyroMark CpG Assay predesigned Pyrosequencing DNA Methylation assays in human, mouse, rat ADCY6
     QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat ADCY6
     QIAGEN QuantiFast Probe-based Assays in human, mouse, rat ADCY6
     QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat ADCY6
     GenScript Custom Purified and Recombinant Proteins Services for ADCY6 GenScript cDNA clones with any tag delivered in your preferred vector for ADCY6
     GenScript Custom Assay Services for ADCY6 GenScript Custom Superior Antibodies Services for ADCY6
     GenScript Custom overexpressing Cell Line Services for ADCY6 CloneReady with Over 120,000 Genes
     Gene Synthesis: Any Gene in Any Vector Vector-based siRNA and miRNA, Ready for Transfection
     Gene Mutant Library, Variants up to 10^11 Plasmid Preparation
     Custom Peptide Services
     Search for Antibodies & Assays

     Regulatory tfbs in ADCY6 promoter
     Search Chromatin IP Primers for ADCY6
     RT2 qPCR Primer Assay in human, mouse, rat ADCY6
     Search GNC Networks for ADCY6
     SABiosciences PCR Arrays including human, mouse, rat ADCY6
     Tocris compounds for ADCY6
     Browse Sino Biological Proteins and Antibodies
     Browse Sino Biological cDNA Clones
     Antibodies/Proteins Production Services
     Rabbit Monoclonal Antibody Platform
     Bulk Purchasing
     Search www.enzolifesciences.com for proteins, assays, substrates, inhibitors & antibodies
     Novus Tissue Slides
     ADCY6 antibodies
     ADCY6 proteins
     Search for Antibodies for ADCY6 at Abcam
     See all of Abcam's Antibodies, Kits and Proteins for ADCY6
     Custom Antibody / Protein Production Service
     Bulk Purchasing
     Advantages of Rabbit Monoclonal antibodies
     Abcam protocols and scientific support
     Browse ProSpec Recombinant Proteins




     ADCY6 Proteins, Antibodies, CLIAs, and ELISAs
     Search LifeMap BioReagents cell lines for ADCY6
     Gene Synthesis
     Protein Engineering
     Variant Library Synthesis
     Codon Optimization
     Protein Production and Purification
     Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for ADCY6
     SwitchGear 3'UTR luciferase reporter plasmids for ADCY6
     SwitchGear Promoter luciferase reporter plasmids for ADCY6
     ThermoFisher Antibodies for ADCY6
     Search Vector BioLabs for ready-to-use adenovirus/AAV for human, mouse, rat ADCY6
           
    GeneCards Homepage - Last full update: 18 Mar 2013 - Incrementals: 21 Mar 2013 , 15 Apr 2013 , 26 Apr 2013

    View Random Gene

    Category
    VWF
    (GIFTS: 73)
    von Willebrand factor
    GIFtS Group
    The GeneCards human gene database gene index: 1 3 5 6 A B C D E F G H I J K L M N O P Q R S T U V W X Y Z 


    Developed at the Crown Human Genome Center, Department of Molecular Genetics, the Weizmann Institute of Science

    Hot genes      Disease genes      ADCY6 gene at Home site.
    hostname: 356977-web1.xennexinc.com index build: 100 solr: 1.4