Free for academic non-profit institutions. Other users need a Commercial license

Aliases for ADCY10 Gene

Aliases for ADCY10 Gene

  • Adenylate Cyclase 10, Soluble 2 3 5
  • Germ Cell Soluble Adenylyl Cyclase 3 4
  • AH-Related Protein 3 4
  • EC 4.6.1.1 4 61
  • HsAC 3 4
  • SAC 3 4
  • Epididymis Secretory Sperm Binding Protein Li 7a 3
  • Testicular Soluble Adenylyl Cyclase (SAC) 3
  • Testicular Soluble Adenylyl Cyclase 4
  • Hypercalciuria, Absorptive, 2 2
  • 3,5-Cyclic AMP Synthetase 3
  • Adenylate Cyclase Type 10 3
  • Adenylate Cyclase Homolog 4
  • Soluble Adenylyl Cyclase 2
  • ATP Pyrophosphate-Lyase 3
  • HEL-S-7a 3
  • HCA2 3
  • SACI 3
  • Sacy 3

External Ids for ADCY10 Gene

Previous GeneCards Identifiers for ADCY10 Gene

  • GC01M166046
  • GC01M139024

Summaries for ADCY10 Gene

Entrez Gene Summary for ADCY10 Gene

  • The protein encoded by this gene belongs to a distinct class of adenylyl cyclases that is soluble and insensitive to G protein or forskolin regulation. Activity of this protein is regulated by bicarbonate. Variation at this gene has been observed in patients with absorptive hypercalciuria. Alternatively spliced transcript variants encoding different isoforms have been observed. There is a pseudogene of this gene on chromosome 6. [provided by RefSeq, Jul 2014]

GeneCards Summary for ADCY10 Gene

ADCY10 (Adenylate Cyclase 10, Soluble) is a Protein Coding gene. Diseases associated with ADCY10 include Hypercalciuria, Absorptive and Idiopathic Hypercalciuria. Among its related pathways are Purine metabolism (KEGG) and Activation of cAMP-Dependent PKA. GO annotations related to this gene include magnesium ion binding and manganese ion binding.

UniProtKB/Swiss-Prot for ADCY10 Gene

  • Catalyzes the formation of the signaling molecule cAMP (PubMed:12609998, PubMed:15659711, PubMed:24616449, PubMed:25040695, PubMed:24567411). May function as sensor that mediates responses to changes in cellular bicarbonate and CO(2) levels (PubMed:15659711, PubMed:17591988). Has a critical role in mammalian spermatogenesis by producing the cAMP which regulates cAMP-responsive nuclear factors indispensable for sperm maturation in the epididymis. Induces capacitation, the maturational process that sperm undergo prior to fertilization (By similarity). Involved in ciliary beat regulation (PubMed:17591988).

Gene Wiki entry for ADCY10 Gene

No data available for Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for ADCY10 Gene

Genomics for ADCY10 Gene

Regulatory Elements for ADCY10 Gene

Enhancers for ADCY10 Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH01F167880 0.9 Ensembl ENCODE 11.8 +34.6 34626 0.2 ADCY10 ENSG00000232194 ENSG00000250762 GC01P167854
GH01F167875 0.2 ENCODE 11.3 +40.0 40030 0.7 PKNOX1 L3MBTL2 ZBTB8A ZNF18 ADCY10 MPC2 TIPRL GC01P167854
GH01F167853 1.1 ENCODE 11.3 +60.9 60870 1.4 NFRKB TAL1 GTF2E2 ZNF175 PYGO2 CEBPG ZNF644 IRF9 NCOR1 ZNF584 ENSG00000232194 ENSG00000250762 ADCY10 GC01P167854
GH01F167867 1.3 Ensembl ENCODE 10.9 +46.2 46197 3.4 HDAC1 ATF1 ARNT CHAMP1 GATA2 ZNF362 ZBTB2 NCOA1 CEBPB ZEB2 ENSG00000232194 ENSG00000250762 ADCY10 GC01P167854
GH01F167865 0.6 ENCODE 10.9 +49.0 48981 1.6 HDGF HDAC1 ATF1 PKNOX1 ARNT NFRKB ZBTB40 CHAMP1 GATA2 KLF13 ENSG00000232194 ENSG00000250762 ADCY10 MPC2 CREG1 GC01P167854
- Elite enhancer/Elite enhancer-gene association Download Table
Download GeneHancer data dump

Enhancers around ADCY10 on UCSC Golden Path with GeneCards custom track

Genomic Location for ADCY10 Gene

Chromosome:
1
Start:
167,809,080 bp from pter
End:
167,915,526 bp from pter
Size:
106,447 bases
Orientation:
Minus strand

Genomic View for ADCY10 Gene

Genes around ADCY10 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
ADCY10 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for ADCY10 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for ADCY10 Gene

Proteins for ADCY10 Gene

  • Protein details for ADCY10 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q96PN6-ADCYA_HUMAN
    Recommended name:
    Adenylate cyclase type 10
    Protein Accession:
    Q96PN6
    Secondary Accessions:
    • B4DZF0
    • F5GWS5
    • O95558
    • Q5R329
    • Q5R330
    • Q8WXV4
    • Q9NNX0

    Protein attributes for ADCY10 Gene

    Size:
    1610 amino acids
    Molecular mass:
    187149 Da
    Cofactor:
    Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Name=Mn(2+); Xref=ChEBI:CHEBI:29035;
    Quaternary structure:
    No Data Available

    Three dimensional structures from OCA and Proteopedia for ADCY10 Gene

    Alternative splice isoforms for ADCY10 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for ADCY10 Gene

Selected DME Specific Peptides for ADCY10 Gene

Q96PN6:
  • DIFDFCSQVHKI
  • LVAQNTTGPVF
  • TVSIGVASGIVFCGIVGHTVRHEYTVIGQKVN
  • EKVMFGMA
  • SRYMEGQVL
  • LSHQMLVRCAAIIGLTFTTELLFEILPCWNMKMMIK
  • AMYMDRGAEQLVEILNY
  • GYLSELRPVTIVFVNLMF
  • YFFKELPKK
  • GQINKVFMFDKGCSFLCVFGFPGEK
  • ISAIVEKVLIFGGDILKFAGDALLALW
  • MANVLGLDTCKHYKERQTNL

Post-translational modifications for ADCY10 Gene

Antibody Products

  • Abcam antibodies for ADCY10

Domains & Families for ADCY10 Gene

Gene Families for ADCY10 Gene

Suggested Antigen Peptide Sequences for ADCY10 Gene

GenScript: Design optimal peptide antigens:

Graphical View of Domain Structure for InterPro Entry

Q96PN6

UniProtKB/Swiss-Prot:

ADCYA_HUMAN :
  • The N-terminal guanylate cyclase domains are required for enzyme activity. Fragments or isoforms containing the first 470 amino acid residues are fully active.
  • Belongs to the adenylyl cyclase class-4/guanylyl cyclase family.
Domain:
  • The N-terminal guanylate cyclase domains are required for enzyme activity. Fragments or isoforms containing the first 470 amino acid residues are fully active.
  • Contains 2 guanylate cyclase domains.
Family:
  • Belongs to the adenylyl cyclase class-4/guanylyl cyclase family.
genes like me logo Genes that share domains with ADCY10: view

Function for ADCY10 Gene

Molecular function for ADCY10 Gene

UniProtKB/Swiss-Prot BiophysicochemicalProperties:
Kinetic parameters: KM=0.8 mM for ATP-Mn(2+) {ECO:0000269 PubMed:12609998}; KM=2.41 mM for Mg(2+) {ECO:0000269 PubMed:12609998};
UniProtKB/Swiss-Prot CatalyticActivity:
ATP = 3,5-cyclic AMP + diphosphate.
UniProtKB/Swiss-Prot EnzymeRegulation:
Activated by manganese or magnesium ions (PubMed:12609998, PubMed:24616449). In the presence of magnesium ions, the enzyme is activated by bicarbonate (PubMed:12609998, PubMed:15659711, PubMed:24567411). In the presence of manganese ions, the enzyme is inhibited by bicarbonate (PubMed:15659711). In the absence of magnesium and bicarbonate, the enzyme is weakly activated by calcium (PubMed:15659711). Calcium mildly increases the enzyme activity, also in the presence of magnesium ions (PubMed:15659711, PubMed:25040695).
UniProtKB/Swiss-Prot Function:
Catalyzes the formation of the signaling molecule cAMP (PubMed:12609998, PubMed:15659711, PubMed:24616449, PubMed:25040695, PubMed:24567411). May function as sensor that mediates responses to changes in cellular bicarbonate and CO(2) levels (PubMed:15659711, PubMed:17591988). Has a critical role in mammalian spermatogenesis by producing the cAMP which regulates cAMP-responsive nuclear factors indispensable for sperm maturation in the epididymis. Induces capacitation, the maturational process that sperm undergo prior to fertilization (By similarity). Involved in ciliary beat regulation (PubMed:17591988).

Enzyme Numbers (IUBMB) for ADCY10 Gene

Gene Ontology (GO) - Molecular Function for ADCY10 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000287 magnesium ion binding IEA --
GO:0004016 adenylate cyclase activity NAS,TAS 9874775
GO:0005524 ATP binding IEA --
GO:0016829 lyase activity IEA --
GO:0016849 phosphorus-oxygen lyase activity IEA --
genes like me logo Genes that share ontologies with ADCY10: view
genes like me logo Genes that share phenotypes with ADCY10: view

Human Phenotype Ontology for ADCY10 Gene

HPO Id HPO Name Alternative Ids Definition Synonyms

Animal Models for ADCY10 Gene

MGI Knock Outs for ADCY10:

Animal Model Products

  • Taconic Biosciences Mouse Models for ADCY10

Inhibitory RNA Products

Flow Cytometry Products

No data available for miRNA , Transcription Factor Targets and HOMER Transcription for ADCY10 Gene

Localization for ADCY10 Gene

Subcellular locations from UniProtKB/Swiss-Prot for ADCY10 Gene

Cell membrane; Peripheral membrane protein; Cytoplasmic side. Cytoplasm, cytoskeleton. Cytoplasm, perinuclear region. Nucleus. Cell projection, cilium. Cytoplasm. Mitochondrion. Note=Distributed to subcellular compartments containing cAMP targets. Found as a plasma membrane-associated protein, protein concentrated in the perinuclear region and protein colocalized with actin or tubulin. {ECO:0000269 PubMed:12475901, ECO:0000269 PubMed:15659711}.

Subcellular locations from

COMPARTMENTS
Jensen Localization Image for ADCY10 Gene COMPARTMENTS Subcellular localization image for ADCY10 gene
Compartment Confidence
cytosol 5
nucleus 5
plasma membrane 5
cytoskeleton 4
mitochondrion 4
chloroplast 2
endoplasmic reticulum 1
extracellular 1
peroxisome 1
vacuole 1

Gene Ontology (GO) - Cellular Components for ADCY10 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005634 nucleus IEA,IDA 15659711
GO:0005737 cytoplasm TAS 9874775
GO:0005739 mitochondrion IEA --
GO:0005829 cytosol NAS 9874775
GO:0005856 cytoskeleton IEA --
genes like me logo Genes that share ontologies with ADCY10: view

Pathways & Interactions for ADCY10 Gene

genes like me logo Genes that share pathways with ADCY10: view

Pathways by source for ADCY10 Gene

SIGNOR curated interactions for ADCY10 Gene

Is activated by:

Gene Ontology (GO) - Biological Process for ADCY10 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0003351 epithelial cilium movement IMP 17591988
GO:0006171 cAMP biosynthetic process NAS 9874775
GO:0007283 spermatogenesis IEA --
GO:0009190 cyclic nucleotide biosynthetic process IEA --
GO:0035556 intracellular signal transduction IEA --
genes like me logo Genes that share ontologies with ADCY10: view

Drugs & Compounds for ADCY10 Gene

(90) Drugs for ADCY10 Gene - From: ApexBio, HMDB, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Adenosine triphosphate Approved Nutra 0
Manganese Approved Nutra 34
cyclic amp Experimental Pharma 0
Cyclic GMP Experimental Pharma 0
Guanosine triphosphate Experimental Pharma 0

(50) Additional Compounds for ADCY10 Gene - From: Novoseek and HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
Hydrogen carbonate
  • Bicarbonate
  • Bicarbonate (HCO3-)
  • Bicarbonate anion
  • Bicarbonate ion
  • Bicarbonate ion (HCO31-)
71-52-3
pyrophosphate
  • (4-)Diphosphoric acid ion
  • (P2O74-)Diphosphate
  • Diphosphate
  • Diphosphoric acid
  • PPi
14000-31-8

(8) ApexBio Compounds for ADCY10 Gene

Compound Action Cas Number
1,9-Dideoxyforskolin 64657-18-7
Forskolin 66575-29-9
KH 7 330676-02-3
MDL 12330A hydrochloride adenylate cyclase inhibitor 40297-09-4
N6-methyladenosine (m6A) adenylate cyclase regulator 1867-73-8
NKH 477 138605-00-2
NKY 80 299442-43-6
SQ 22536 17318-31-9
genes like me logo Genes that share compounds with ADCY10: view

Transcripts for ADCY10 Gene

mRNA/cDNA for ADCY10 Gene

Unigene Clusters for ADCY10 Gene

Adenylate cyclase 10 (soluble):
Representative Sequences:

Inhibitory RNA Products

Flow Cytometry Products

Alternative Splicing Database (ASD) splice patterns (SP) for ADCY10 Gene

ExUns: 1a · 1b · 1c · 1d ^ 2 ^ 3a · 3b ^ 4a · 4b ^ 5 ^ 6a · 6b ^ 7 ^ 8 ^ 9 ^ 10 ^ 11 ^ 12 ^ 13 ^ 14 ^ 15a · 15b · 15c ^ 16 ^ 17 ^ 18 ^
SP1: - - -
SP2: - - - -
SP3:
SP4: - -
SP5: -
SP6: -
SP7:
SP8: -

ExUns: 19 ^ 20 ^ 21 ^ 22 ^ 23 ^ 24 ^ 25 ^ 26 ^ 27 ^ 28 ^ 29 ^ 30 ^ 31 ^ 32 ^ 33 ^ 34 ^ 35 ^ 36a · 36b
SP1: - -
SP2: - -
SP3: - -
SP4:
SP5:
SP6:
SP7: - -
SP8:

Relevant External Links for ADCY10 Gene

GeneLoc Exon Structure for
ADCY10
ECgene alternative splicing isoforms for
ADCY10

Expression for ADCY10 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for ADCY10 Gene

mRNA differential expression in normal tissues according to GTEx for ADCY10 Gene

This gene is overexpressed in Testis (x23.6) and Liver (x9.7).

Protein differential expression in normal tissues from HIPED for ADCY10 Gene

This gene is overexpressed in Testis (38.9), Liver, secretome (12.3), Plasma (9.2), and Neutrophil (8.1).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB and MOPED for ADCY10 Gene



Protein tissue co-expression partners for ADCY10 Gene

NURSA nuclear receptor signaling pathways regulating expression of ADCY10 Gene:

ADCY10

SOURCE GeneReport for Unigene cluster for ADCY10 Gene:

Hs.320892

mRNA Expression by UniProt/SwissProt for ADCY10 Gene:

Q96PN6-ADCYA_HUMAN
Tissue specificity: Detected in airway epithelial cells and testis (at protein level) (PubMed:17591988). Weakly expressed in multiple tissues. Expressed in brain, heart, kidney, liver, lung, pancreas, peripheral blood leukocytes, placenta, skeletal muscle, stomach, thymus, airway epithelial cells, duodenum, jejunum and ileum. Very low level of expression in bone.
genes like me logo Genes that share expression patterns with ADCY10: view

Primer Products

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery for ADCY10 Gene

Orthologs for ADCY10 Gene

This gene was present in the common ancestor of animals.

Orthologs for ADCY10 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia ADCY10 34 35
  • 99.25 (n)
dog
(Canis familiaris)
Mammalia ADCY10 34 35
  • 86.13 (n)
cow
(Bos Taurus)
Mammalia ADCY10 34 35
  • 85.65 (n)
mouse
(Mus musculus)
Mammalia Adcy10 34 16 35
  • 81.77 (n)
rat
(Rattus norvegicus)
Mammalia Adcy10 34
  • 81.35 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia -- 35
  • 67 (a)
OneToMany
-- 35
  • 60 (a)
OneToMany
oppossum
(Monodelphis domestica)
Mammalia ADCY10 35
  • 63 (a)
OneToOne
chicken
(Gallus gallus)
Aves LOC101751665 34
  • 63.25 (n)
-- 35
  • 40 (a)
OneToMany
-- 35
  • 35 (a)
OneToMany
-- 35
  • 35 (a)
OneToMany
-- 35
  • 34 (a)
OneToMany
-- 35
  • 32 (a)
OneToMany
-- 35
  • 31 (a)
OneToMany
lizard
(Anolis carolinensis)
Reptilia ADCY10 35
  • 41 (a)
OneToOne
African malaria mosquito
(Anopheles gambiae)
Insecta AgaP_AGAP008683 34
  • 47.79 (n)
sea squirt
(Ciona savignyi)
Ascidiacea -- 35
  • 37 (a)
OneToOne
Species where no ortholog for ADCY10 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • fruit fly (Drosophila melanogaster)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • tropical clawed frog (Silurana tropicalis)
  • wheat (Triticum aestivum)
  • worm (Caenorhabditis elegans)
  • zebrafish (Danio rerio)

Evolution for ADCY10 Gene

ENSEMBL:
Gene Tree for ADCY10 (if available)
TreeFam:
Gene Tree for ADCY10 (if available)

Paralogs for ADCY10 Gene

Pseudogenes.org Pseudogenes for ADCY10 Gene

genes like me logo Genes that share paralogs with ADCY10: view

No data available for Paralogs for ADCY10 Gene

Variants for ADCY10 Gene

Sequence variations from dbSNP and Humsavar for ADCY10 Gene

SNP ID Clin Chr 01 pos Sequence Context AA Info Type
rs1004127 -- 167,828,354(-) aaagt(A/G)cacat intron-variant
rs10127791 -- 167,853,724(+) GCAAT(G/T)TTACC intron-variant
rs1018816 -- 167,853,358(+) agatg(A/T)cattg intron-variant
rs1034463 -- 167,837,409(+) CCTTT(A/T)CGGAG intron-variant
rs1034464 -- 167,837,458(+) CATTG(C/T)ATCTT intron-variant

Structural Variations from Database of Genomic Variants (DGV) for ADCY10 Gene

Variant ID Type Subtype PubMed ID
esv2719217 CNV deletion 23290073
esv32660 CNV loss 17666407
esv3309011 CNV mobile element insertion 20981092
esv3328988 CNV insertion 20981092
esv3330175 CNV duplication 20981092
esv3427330 CNV insertion 20981092
nsv1002698 CNV loss 25217958
nsv1078878 OTHER inversion 25765185
nsv464239 CNV loss 19166990
nsv527119 CNV loss 19592680
nsv548132 CNV loss 21841781

Variation tolerance for ADCY10 Gene

Residual Variation Intolerance Score: 76.3% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 5.40; 71.13% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for ADCY10 Gene

Human Gene Mutation Database (HGMD)
ADCY10
SNPedia medical, phenotypic, and genealogical associations of SNPs for
ADCY10

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for ADCY10 Gene

Disorders for ADCY10 Gene

MalaCards: The human disease database

(15) MalaCards diseases for ADCY10 Gene - From: OMIM, GeneTests, Orphanet, DISEASES, Novoseek, and GeneCards

Disorder Aliases PubMed IDs
hypercalciuria, absorptive
  • hypercalciuria, absorptive 2
idiopathic hypercalciuria
cholera
  • cholera - vibrio cholerae
brain ischemia
pseudohypoparathyroidism, type ii
  • pseudohypoparathyroidism type 2
- elite association - COSMIC cancer census association via MalaCards

UniProtKB/Swiss-Prot

ADCYA_HUMAN
  • Hypercalciuria absorptive 2 (HCA2) [MIM:143870]: A common type of hypercalciuria, a condition characterized by excessive urinary calcium excretion. Absorptive hypercalciuria is due to gastrointestinal hyperabsorption of calcium and is a frequent cause of calcium oxalate nephrolithiasis. {ECO:0000269 PubMed:11932268}. Note=Disease susceptibility is associated with variations affecting the gene represented in this entry.

Relevant External Links for ADCY10

Genetic Association Database (GAD)
ADCY10
Human Genome Epidemiology (HuGE) Navigator
ADCY10
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
ADCY10
genes like me logo Genes that share disorders with ADCY10: view

No data available for Genatlas for ADCY10 Gene

Publications for ADCY10 Gene

  1. Soluble adenylyl cyclase is localized to cilia and contributes to ciliary beat frequency regulation via production of cAMP. (PMID: 17591988) Schmid A. … Salathe M. (J. Gen. Physiol. 2007) 3 4 22 64
  2. Kinetic properties of 'soluble' adenylyl cyclase. Synergism between calcium and bicarbonate. (PMID: 12609998) Litvin T.N. … Levin L.R. (J. Biol. Chem. 2003) 3 4 22 64
  3. Crystal structures of human soluble adenylyl cyclase reveal mechanisms of catalysis and of its activation through bicarbonate. (PMID: 24567411) Kleinboelting S. … Steegborn C. (Proc. Natl. Acad. Sci. U.S.A. 2014) 3 4 64
  4. Structural analysis of human soluble adenylyl cyclase and crystal structures of its nucleotide complexes-implications for cyclase catalysis and evolution. (PMID: 25040695) Kleinboelting S. … Steegborn C. (FEBS J. 2014) 3 4 64
  5. Type 10 soluble adenylyl cyclase is overexpressed in prostate carcinoma and controls proliferation of prostate cancer cells. (PMID: 23255611) Flacke J.P. … Ladilov Y. (J. Biol. Chem. 2013) 2 3 64

Products for ADCY10 Gene

Sources for ADCY10 Gene

Content
Loading form....