Free for academic non-profit institutions. Other users need a Commercial license

Aliases for ACE2 Gene

Aliases for ACE2 Gene

  • Angiotensin I Converting Enzyme 2 2 3 5
  • Angiotensin I Converting Enzyme (Peptidyl-Dipeptidase A) 2 2 3
  • Angiotensin-Converting Enzyme Homolog 3 4
  • ACE-Related Carboxypeptidase 3 4
  • Metalloprotease MPROT15 3 4
  • Peptidyl-Dipeptidase A 2 3
  • ACEH 3 4
  • Angiotensin-Converting Enzyme 2 3
  • EC 3.4.17.23 4
  • EC 3.4.17 56

External Ids for ACE2 Gene

Previous GeneCards Identifiers for ACE2 Gene

  • GC0XM015289
  • GC0XM014404
  • GC0XM014781
  • GC0XM014940
  • GC0XM015338
  • GC0XM015489
  • GC0XM013333

Summaries for ACE2 Gene

Entrez Gene Summary for ACE2 Gene

  • The protein encoded by this gene belongs to the angiotensin-converting enzyme family of dipeptidyl carboxydipeptidases and has considerable homology to human angiotensin 1 converting enzyme. This secreted protein catalyzes the cleavage of angiotensin I into angiotensin 1-9, and angiotensin II into the vasodilator angiotensin 1-7. The organ- and cell-specific expression of this gene suggests that it may play a role in the regulation of cardiovascular and renal function, as well as fertility. In addition, the encoded protein is a functional receptor for the spike glycoprotein of the human coronaviruses SARS and HCoV-NL63. [provided by RefSeq, Jul 2008]

GeneCards Summary for ACE2 Gene

ACE2 (Angiotensin I Converting Enzyme 2) is a Protein Coding gene. Diseases associated with ACE2 include Severe Acute Respiratory Syndrome and Neurogenic Hypertension. Among its related pathways are Peptide hormone metabolism and Collagen chain trimerization. Gene Ontology (GO) annotations related to this gene include metallopeptidase activity and peptide binding. An important paralog of this gene is ACE.

UniProtKB/Swiss-Prot for ACE2 Gene

  • Carboxypeptidase which converts angiotensin I to angiotensin 1-9, a peptide of unknown function, and angiotensin II to angiotensin 1-7, a vasodilator. Also able to hydrolyze apelin-13 and dynorphin-13 with high efficiency. May be an important regulator of heart function.

  • (Microbial infection) Acts as a receptor for SARS coronavirus/SARS-CoV and human coronavirus NL63/HCoV-NL63.

Tocris Summary for ACE2 Gene

  • Angiotensin-converting enzyme (ACE, aka peptidyl dipeptidase A, carboxycathepsin) cleaves a C-terminal dipeptide from angiotensin I to create the vasoconstrictor peptide, angiotensin II. ACE can also inactivate the vasodilator, proinflammatory peptide, bradykinin.

Gene Wiki entry for ACE2 Gene

Additional gene information for ACE2 Gene

No data available for CIViC summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for ACE2 Gene

Genomics for ACE2 Gene

GeneHancer (GH) Regulatory Elements for ACE2 Gene

Promoters and enhancers for ACE2 Gene
GeneHancer (GH) Identifier GH Type GH
Score
GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites
Gene Targets
GH0XI015596 Promoter/Enhancer 1.2 EPDnew ENCODE 550.8 +2.6 2554 6.7 SOX13 FOXA2 SAP130 JUN CEBPG RARA TEAD3 GATA3 NR2F6 HOMEZ ACE2 CLTRN PIR CA5BP1 CA5B GS1-594A7.3
GH0XI015579 Enhancer 1 Ensembl ENCODE 12.1 +21.6 21629 1.5 HDAC1 ATF1 TAF9B ZBTB40 NCOA2 CHAMP1 TCF12 GATA2 CREM ZBTB2 PIR GS1-594A7.3 ACE2 CLTRN
GH0XI015356 Enhancer 0.6 ENCODE 11.2 +245.5 245504 0.1 FOXA2 HLF CEBPB RAD21 FOXA1 YY1 MITF JUND HNF4A PIGA ASB11 BMX PIR ACE2 GS1-594A7.3 VEGFD PIR-FIGF
GH0XI015507 Promoter 0.5 EPDnew 10.8 +94.9 94857 0.1 BMX ACE2 GS1-594A7.3 PIR
GH0XI015564 Enhancer 0.6 ENCODE 0.3 +36.7 36719 1 CTCF STAT1 ZNF654 RFX1 TRIM22 REST RAD21 CC2D1A GATA3 ARID2 PIR BMX ACE2
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data dump

GeneHancers around ACE2 on UCSC Golden Path with GeneCards custom track

Top Transcription factor binding sites by QIAGEN in the ACE2 gene promoter:

Genomic Locations for ACE2 Gene

Genomic Locations for ACE2 Gene
chrX:15,494,402-15,602,148
(GRCh38/hg38)
Size:
107,747 bases
Orientation:
Minus strand
chrX:15,579,156-15,620,271
(GRCh37/hg19)

Genomic View for ACE2 Gene

Genes around ACE2 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
ACE2 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for ACE2 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for ACE2 Gene

Proteins for ACE2 Gene

  • Protein details for ACE2 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q9BYF1-ACE2_HUMAN
    Recommended name:
    Angiotensin-converting enzyme 2
    Protein Accession:
    Q9BYF1
    Secondary Accessions:
    • C7ECU1
    • Q6UWP0
    • Q86WT0
    • Q9NRA7
    • Q9UFZ6

    Protein attributes for ACE2 Gene

    Size:
    805 amino acids
    Molecular mass:
    92463 Da
    Cofactor:
    Name=chloride; Xref=ChEBI:CHEBI:17996;
    Cofactor:
    Name=Zn(2+); Xref=ChEBI:CHEBI:29105;
    Quaternary structure:
    • Interacts with ITGB1. Interacts with the catalytically active form of TMPRSS2.
    • (Microbial infection) Interacts with SARS coronavirus/SARS-CoV and human coronavirus NL63/HCoV-NL63 spike glycoprotein (PubMed:14647384, PubMed:15452268, PubMed:15791205, PubMed:15897467).

    Three dimensional structures from OCA and Proteopedia for ACE2 Gene

    Alternative splice isoforms for ACE2 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for ACE2 Gene

Selected DME Specific Peptides for ACE2 Gene

Q9BYF1:
  • PWTLALE
  • PHDETYCDPA
  • FLTAHHEMGHIQYDMAYA
  • ETEINFLLKQALTIVGTLPFTYMLEKWRWMVF
  • DQSIKVRISLKSALG
  • YFEPLFTWLK
  • LLRNGANEGFHEAVGEIMSLSAATP
  • VCHPTAWDLGKGDFRI
  • GCLPAHLLGDMWGRFWTNLY
  • WLLLSLVAV
  • MSTIYSTGK
  • DNSLEFLGI
  • DYGDYWRGDYE
  • QKPNIDVTDAM
  • YPSYISP
  • KWWEMKR
  • NPQECLLLEPGL
  • SFNFFVT
  • ASWNYNTNIT

Post-translational modifications for ACE2 Gene

  • N-glycosylation on Asn-90 may limit SARS infectivity.
  • Proteolytic cleavage by ADAM17 generates a secreted form. Also cleaved by serine proteases: TMPRSS2, TMPRSS11D and HPN/TMPRSS1.
  • Glycosylation at Asn53, posLast=9090, Asn103, Asn322, posLast=432432, posLast=546546, and Asn690

Other Protein References for ACE2 Gene

Domains & Families for ACE2 Gene

Gene Families for ACE2 Gene

IUPHAR :
Human Protein Atlas (HPA):
  • Enzymes
  • FDA approved drug targets
  • Predicted membrane proteins

Suggested Antigen Peptide Sequences for ACE2 Gene

Graphical View of Domain Structure for InterPro Entry

Q9BYF1

UniProtKB/Swiss-Prot:

ACE2_HUMAN :
  • Belongs to the peptidase M2 family.
Family:
  • Belongs to the peptidase M2 family.
genes like me logo Genes that share domains with ACE2: view

Function for ACE2 Gene

Molecular function for ACE2 Gene

UniProtKB/Swiss-Prot BiophysicochemicalProperties:
Kinetic parameters: KM=6.9 uM for angiotensin I {ECO:0000269 PubMed:11815627}; KM=2 uM for angiotensin II {ECO:0000269 PubMed:11815627}; KM=6.8 uM for apelin-13 {ECO:0000269 PubMed:11815627}; KM=5.5 uM for dynorphin-13 {ECO:0000269 PubMed:11815627}; pH dependence: Optimum pH is 6.5 in the presence of 1 M NaCl. Active from pH 6 to 9. {ECO:0000269 PubMed:11815627};
UniProtKB/Swiss-Prot CatalyticActivity:
Angiotensin II + H(2)O = angiotensin-(1-7) + L-phenylalanine.
UniProtKB/Swiss-Prot EnzymeRegulation:
Activated by chloride and fluoride, but not bromide. Inhibited by MLN-4760, cFP_Leu, and EDTA, but not by the ACE inhibitors linosipril, captopril and enalaprilat.
UniProtKB/Swiss-Prot Function:
Carboxypeptidase which converts angiotensin I to angiotensin 1-9, a peptide of unknown function, and angiotensin II to angiotensin 1-7, a vasodilator. Also able to hydrolyze apelin-13 and dynorphin-13 with high efficiency. May be an important regulator of heart function.
UniProtKB/Swiss-Prot Function:
(Microbial infection) Acts as a receptor for SARS coronavirus/SARS-CoV and human coronavirus NL63/HCoV-NL63.
UniProtKB/Swiss-Prot Induction:
Up-regulated in failing heart.

Enzyme Numbers (IUBMB) for ACE2 Gene

Gene Ontology (GO) - Molecular Function for ACE2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0001618 virus receptor activity IMP 24227843
GO:0004175 endopeptidase activity IDA 15283675
GO:0004180 carboxypeptidase activity IDA,IEA 10924499
GO:0004181 metallocarboxypeptidase activity EXP 10924499
GO:0005515 protein binding IPI 18343844
genes like me logo Genes that share ontologies with ACE2: view
genes like me logo Genes that share phenotypes with ACE2: view

Animal Models for ACE2 Gene

MGI Knock Outs for ACE2:

miRNA for ACE2 Gene

miRTarBase miRNAs that target ACE2

Clone Products

  • Addgene plasmids for ACE2

No data available for Phenotypes From GWAS Catalog , Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for ACE2 Gene

Localization for ACE2 Gene

Subcellular locations from UniProtKB/Swiss-Prot for ACE2 Gene

Processed angiotensin-converting enzyme 2: Secreted.
Cell membrane; Single-pass type I membrane protein. Cytoplasm. Note=Detected in both cell membrane and cytoplasm in neurons. {ECO:0000250}.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for ACE2 gene
Compartment Confidence
plasma membrane 5
extracellular 5
peroxisome 2
nucleus 2
endoplasmic reticulum 2
cytoskeleton 1
mitochondrion 1
cytosol 1
lysosome 1
endosome 1

Gene Ontology (GO) - Cellular Components for ACE2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005576 extracellular region IEA,IDA 10969042
GO:0005615 extracellular space IDA 18258853
GO:0005737 cytoplasm IEA --
GO:0005886 plasma membrane TAS --
GO:0009986 cell surface IDA 18343844
genes like me logo Genes that share ontologies with ACE2: view

No data available for Subcellular locations from the Human Protein Atlas (HPA) for ACE2 Gene

Pathways & Interactions for ACE2 Gene

genes like me logo Genes that share pathways with ACE2: view

Gene Ontology (GO) - Biological Process for ACE2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0001817 regulation of cytokine production IC 15380922
GO:0002003 angiotensin maturation TAS --
GO:0002005 angiotensin catabolic process in blood IC 10924499
GO:0003051 angiotensin-mediated drinking behavior IMP 18258853
GO:0003081 regulation of systemic arterial blood pressure by renin-angiotensin IMP 18258853
genes like me logo Genes that share ontologies with ACE2: view

No data available for SIGNOR curated interactions for ACE2 Gene

Drugs & Compounds for ACE2 Gene

(29) Drugs for ACE2 Gene - From: DrugBank, PharmGKB, ClinicalTrials, ApexBio, DGIdb, IUPHAR, HMDB, Tocris, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Captopril Approved Pharma Inhibition, Inhibitor ACE inhibitor, ACE inhibitor; also inhibits LTA4 hydrolase 37
Moexipril Approved Pharma Target, inhibitor 8
Angiotensin II Approved, Investigational Pharma Full agonist, Agonist Potent vasopressor and a powerful stimulus for production and release of aldosterone from the adrenal cortex. 1217
Lisinopril Approved, Investigational Pharma inhibitor ACE inhibitor 123
Ramipril Approved Pharma 155

(7) Additional Compounds for ACE2 Gene - From: Novoseek, HMDB, and Tocris

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
Chloride ion
  • Bertholite
  • Chloor
  • Chlor
  • Chlore
  • Chloride
16887-00-6
Benazepril hydrochloride
86541-74-4
Moexipril hydrochloride
82586-52-5

(5) Tocris Compounds for ACE2 Gene

Compound Action Cas Number
Benazepril hydrochloride Angiotensin-converting enzyme (ACE) inhibitor 86541-74-4
Captopril ACE inhibitor; also inhibits LTA4 hydrolase 62571-86-2
Moexipril hydrochloride Angiotensin-converting enzyme (ACE) inhibitor 82586-52-5
Perindopril erbumine Angiotensin-converting enzyme (ACE) inhibitor 107133-36-8
Spinorphin Enkephalin-degrading and ACE inhibitor 137201-62-8

(6) ApexBio Compounds for ACE2 Gene

Compound Action Cas Number
Acetyl Angiotensinogen (1-14), porcine Angiotensinogen precursor 66641-26-7
Angiotensin 1/2 (1-5) Vasoconstrictor 58442-64-1
Angiotensin 1/2 + A (2 - 8) 51833-76-2
Angiotensin I (human, mouse, rat) Precursor of angiotensin II 484-42-4
Enalaprilat Dihydrate 84680-54-6
Ramipril 87333-19-5
genes like me logo Genes that share compounds with ACE2: view

Drug Products

Transcripts for ACE2 Gene

Unigene Clusters for ACE2 Gene

Angiotensin I converting enzyme (peptidyl-dipeptidase A) 2:
Representative Sequences:

Clone Products

  • Addgene plasmids for ACE2

Alternative Splicing Database (ASD) splice patterns (SP) for ACE2 Gene

ExUns: 1a · 1b ^ 2a · 2b · 2c ^ 3 ^ 4a · 4b · 4c ^ 5a · 5b ^ 6 ^ 7 ^ 8 ^ 9 ^ 10a · 10b ^ 11 ^ 12 ^ 13a · 13b ^ 14 ^ 15a · 15b ^ 16 ^ 17a ·
SP1:
SP2: -
SP3: - -
SP4: - -
SP5:
SP6: -

ExUns: 17b ^ 18 ^ 19 ^ 20
SP1:
SP2:
SP3:
SP4:
SP5:
SP6:

Relevant External Links for ACE2 Gene

GeneLoc Exon Structure for
ACE2
ECgene alternative splicing isoforms for
ACE2

Expression for ACE2 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for ACE2 Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

mRNA differential expression in normal tissues according to GTEx for ACE2 Gene

This gene is overexpressed in Small Intestine - Terminal Ileum (x13.3), Testis (x7.7), and Heart - Left Ventricle (x6.6).

Protein differential expression in normal tissues from HIPED for ACE2 Gene

This gene is overexpressed in Ovary (30.4), Urine (19.6), and Pancreatic juice (14.2).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, and MOPED for ACE2 Gene



NURSA nuclear receptor signaling pathways regulating expression of ACE2 Gene:

ACE2

SOURCE GeneReport for Unigene cluster for ACE2 Gene:

Hs.178098

mRNA Expression by UniProt/SwissProt for ACE2 Gene:

Q9BYF1-ACE2_HUMAN
Tissue specificity: Expressed in endothelial cells from small and large arteries, and in arterial smooth muscle cells. Expressed in lung alveolar epithelial cells, enterocytes of the small intestine, Leydig cells and Sertoli cells (at protein level). Expressed in heart, kidney, testis, and gastrointestinal system.

Evidence on tissue expression from TISSUES for ACE2 Gene

  • Heart(4.6)
  • Lung(4.5)
  • Nervous system(4.4)
  • Liver(4.3)
  • Kidney(3.7)
  • Muscle(2.8)
  • Blood(2.6)
  • Gall bladder(2.2)
genes like me logo Genes that share expression patterns with ACE2: view

No data available for Protein tissue co-expression partners and Phenotype-based relationships between genes and organs from Gene ORGANizer for ACE2 Gene

Orthologs for ACE2 Gene

This gene was present in the common ancestor of animals.

Orthologs for ACE2 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia ACE2 34 33
  • 98.53 (n)
OneToOne
dog
(Canis familiaris)
Mammalia ACE2 34 33
  • 86.95 (n)
OneToOne
cow
(Bos Taurus)
Mammalia ACE2 34 33
  • 85.24 (n)
OneToOne
mouse
(Mus musculus)
Mammalia Ace2 16 34 33
  • 85.1 (n)
rat
(Rattus norvegicus)
Mammalia Ace2 33
  • 84.93 (n)
oppossum
(Monodelphis domestica)
Mammalia ACE2 34
  • 71 (a)
OneToOne
platypus
(Ornithorhynchus anatinus)
Mammalia ACE2 34
  • 69 (a)
OneToOne
chicken
(Gallus gallus)
Aves ACE2 33 34
  • 68.7 (n)
lizard
(Anolis carolinensis)
Reptilia ACE2 34
  • 63 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia ace2 33
  • 64.56 (n)
zebrafish
(Danio rerio)
Actinopterygii ace2 33 34
  • 61.1 (n)
rainbow trout
(Oncorhynchus mykiss)
Actinopterygii Omy.2478 33
fruit fly
(Drosophila melanogaster)
Insecta Acer 35 34
  • 35 (a)
Ance 34
  • 35 (a)
ManyToMany
Ance-2 35
  • 23 (a)
worm
(Caenorhabditis elegans)
Secernentea acn-1 33 34
  • 42.11 (n)
sea squirt
(Ciona savignyi)
Ascidiacea -- 34
  • 21 (a)
ManyToMany
Species where no ortholog for ACE2 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for ACE2 Gene

ENSEMBL:
Gene Tree for ACE2 (if available)
TreeFam:
Gene Tree for ACE2 (if available)

Paralogs for ACE2 Gene

Paralogs for ACE2 Gene

(2) SIMAP similar genes for ACE2 Gene using alignment to 1 proteins:

genes like me logo Genes that share paralogs with ACE2: view

Variants for ACE2 Gene

Sequence variations from dbSNP and Humsavar for ACE2 Gene

SNP ID Clin Chr 0X pos Variation AA Info Type
rs1000009210 -- 15,527,253(-) T/G genic_downstream_transcript_variant, intron_variant
rs1000064566 -- 15,501,225(-) G/A genic_downstream_transcript_variant, intron_variant
rs1000074234 -- 15,572,914(-) C/T intron_variant
rs1000204510 -- 15,597,673(-) A/G intron_variant
rs1000216366 -- 15,544,003(-) C/G genic_downstream_transcript_variant, intron_variant

Structural Variations from Database of Genomic Variants (DGV) for ACE2 Gene

Variant ID Type Subtype PubMed ID
nsv1125275 CNV insertion 24896259

Variation tolerance for ACE2 Gene

Residual Variation Intolerance Score: 49.9% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 1.61; 31.01% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for ACE2 Gene

Human Gene Mutation Database (HGMD)
ACE2
SNPedia medical, phenotypic, and genealogical associations of SNPs for
ACE2

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for ACE2 Gene

Disorders for ACE2 Gene

MalaCards: The human disease database

(9) MalaCards diseases for ACE2 Gene - From: HGMD, DISEASES, Novoseek, and GeneCards

- elite association - COSMIC cancer census association via MalaCards
Search ACE2 in MalaCards View complete list of genes associated with diseases

Additional Disease Information for ACE2

Genetic Association Database
(GAD)
Human Genome Epidemiology Navigator
(HuGE)
ATLAS of Genetics and Cytogenetics in Oncology and Haematology
genes like me logo Genes that share disorders with ACE2: view

No data available for UniProtKB/Swiss-Prot and Genatlas for ACE2 Gene

Publications for ACE2 Gene

  1. A novel angiotensin-converting enzyme-related carboxypeptidase (ACE2) converts angiotensin I to angiotensin 1-9. (PMID: 10969042) Donoghue M … Acton S (Circulation research 2000) 2 3 4 22 58
  2. [Relationship of angiotensin-converting enzyme 2 gene polymorphisms and vulnerability to coronary heart disease in patients with type 2 diabetes mellitus]. (PMID: 18753062) Yan QN … Jiang CX (Nan fang yi ke da xue xue bao = Journal of Southern Medical University 2008) 3 22 44 58
  3. Polymorphisms of ACE2 gene are associated with essential hypertension and antihypertensive effects of Captopril in women. (PMID: 17473847) Fan X … Study Group for Pharmacogenomic Based Antihypertensive Drugs Selection, Effects and Side Effects, in Rural Area Chinese (Clinical pharmacology and therapeutics 2007) 3 22 44 58
  4. Association of angiotensin-converting enzyme 2 (ACE2) gene polymorphisms with parameters of left ventricular hypertrophy in men. Results of the MONICA Augsburg echocardiographic substudy. (PMID: 16283142) Lieb W … Erdmann J (Journal of molecular medicine (Berlin, Germany) 2006) 3 22 44 58
  5. Association analysis of common variants of ELN, NOS2A, APOE and ACE2 to intracranial aneurysm. (PMID: 16574921) Mineharu Y … Koizumi A (Stroke 2006) 3 22 44 58

Products for ACE2 Gene

Sources for ACE2 Gene

Content
Loading form....