Free for academic non-profit institutions. Other users need a Commercial license

ACE2 Gene(Protein Coding)

Angiotensin I Converting Enzyme 2

GCID:
GC0XM015579
GIFtS:
69
Genes Participants
UDN Logo

Aliases for ACE2 Gene

Aliases for ACE2 Gene

  • Angiotensin I Converting Enzyme 2 2 3 5
  • Angiotensin I Converting Enzyme (Peptidyl-Dipeptidase A) 2 2 3
  • Angiotensin-Converting Enzyme Homolog 3 4
  • ACE-Related Carboxypeptidase 3 4
  • Metalloprotease MPROT15 3 4
  • Peptidyl-Dipeptidase A 2 3
  • ACEH 3 4
  • Angiotensin-Converting Enzyme 2 3
  • EC 3.4.17.23 4
  • EC 3.4.17 61

External Ids for ACE2 Gene

Previous GeneCards Identifiers for ACE2 Gene

  • GC0XM015289
  • GC0XM014404
  • GC0XM014781
  • GC0XM014940
  • GC0XM015338
  • GC0XM015489
  • GC0XM013333

Summaries for ACE2 Gene

Entrez Gene Summary for ACE2 Gene

  • The protein encoded by this gene belongs to the angiotensin-converting enzyme family of dipeptidyl carboxydipeptidases and has considerable homology to human angiotensin 1 converting enzyme. This secreted protein catalyzes the cleavage of angiotensin I into angiotensin 1-9, and angiotensin II into the vasodilator angiotensin 1-7. The organ- and cell-specific expression of this gene suggests that it may play a role in the regulation of cardiovascular and renal function, as well as fertility. In addition, the encoded protein is a functional receptor for the spike glycoprotein of the human coronaviruses SARS and HCoV-NL63. [provided by RefSeq, Jul 2008]

GeneCards Summary for ACE2 Gene

ACE2 (Angiotensin I Converting Enzyme 2) is a Protein Coding gene. Diseases associated with ACE2 include Neurogenic Hypertension and Severe Acute Respiratory Syndrome. Among its related pathways are Collagen chain trimerization and Agents Acting on the Renin-Angiotensin System Pathway, Pharmacodynamics. GO annotations related to this gene include metallopeptidase activity and peptide binding. An important paralog of this gene is ACE.

UniProtKB/Swiss-Prot for ACE2 Gene

  • Carboxypeptidase which converts angiotensin I to angiotensin 1-9, a peptide of unknown function, and angiotensin II to angiotensin 1-7, a vasodilator. Also able to hydrolyze apelin-13 and dynorphin-13 with high efficiency. May be an important regulator of heart function.

  • (Microbial infection) Acts as a receptor for SARS coronavirus/SARS-CoV and human coronavirus NL63/HCoV-NL63.

Tocris Summary for ACE2 Gene

  • Angiotensin-converting enzyme (ACE, aka peptidyl dipeptidase A, carboxycathepsin) cleaves a C-terminal dipeptide from angiotensin I to create the vasoconstrictor peptide, angiotensin II. ACE can also inactivate the vasodilator, proinflammatory peptide, bradykinin.

Gene Wiki entry for ACE2 Gene

No data available for CIViC summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for ACE2 Gene

Genomics for ACE2 Gene

Products:

  1. Regulatory Element

Regulatory Elements for ACE2 Gene

Enhancers for ACE2 Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH0XG015579 1.1 Ensembl ENCODE 12.1 +21.6 21630 1.5 HDAC1 CBX3 ATF1 TBL1XR1 CHAMP1 TCF12 GATA2 CREM ZBTB2 JUNB PIR GS1-594A7.3 ACE2 TMEM27
GH0XG015356 0.6 ENCODE 11.2 +245.5 245505 0.1 HLF CEBPB RAD21 YY1 FOXA1 JUND FOXP2 HNF4A PIGA ASB11 BMX PIR ACE2 GS1-594A7.3 VEGFD
GH0XG015596 0.8 ENCODE 0.7 +2.6 2555 6.7 SOX13 FOXA2 SAP130 JUN CEBPG RARA TEAD3 GATA3 CTBP1 NCOR1 TMEM27 PIR CA5BP1 CA5B ACE2
GH0XG015564 0.7 ENCODE 0.3 +36.7 36720 1.0 GTF2F1 CTCF ZNF654 STAT1 RFX1 TRIM22 REST RAD21 GATA2 SMC3 PIR BMX ACE2
GH0XG015516 0.9 ENCODE 0.2 +86.1 86079 1.2 HDAC1 CBX3 ATF1 TBL1XR1 ARNT ZBTB40 CHAMP1 TCF12 ZNF766 GATA2 PIR ACE2
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around ACE2 on UCSC Golden Path with GeneCards custom track

Transcription factor binding sites by QIAGEN in the ACE2 gene promoter:

Genomic Location for ACE2 Gene

Chromosome:
X
Start:
15,494,402 bp from pter
End:
15,602,148 bp from pter
Size:
107,747 bases
Orientation:
Minus strand

Genomic View for ACE2 Gene

Genes around ACE2 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
ACE2 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for ACE2 Gene
GeneLoc Logo Genomic Neighborhood • Exon Structure • Gene Density

RefSeq DNA sequence for ACE2 Gene

Proteins for ACE2 Gene

Products:

  1. Antibody
  2. Protein
  3. Assay

  • Protein details for ACE2 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q9BYF1-ACE2_HUMAN
    Recommended name:
    Angiotensin-converting enzyme 2
    Protein Accession:
    Q9BYF1
    Secondary Accessions:
    • C7ECU1
    • Q6UWP0
    • Q86WT0
    • Q9NRA7
    • Q9UFZ6

    Protein attributes for ACE2 Gene

    Size:
    805 amino acids
    Molecular mass:
    92463 Da
    Cofactor:
    Name=chloride; Xref=ChEBI:CHEBI:17996;
    Cofactor:
    Name=Zn(2+); Xref=ChEBI:CHEBI:29105;
    Quaternary structure:
    • Interacts with ITGB1. Interacts with the catalytically active form of TMPRSS2.
    • (Microbial infection) Interacts with SARS coronavirus/SARS-CoV and human coronavirus NL63/HCoV-NL63 spike glycoprotein (PubMed:14647384, PubMed:15452268, PubMed:15791205, PubMed:15897467).

    Three dimensional structures from OCA and Proteopedia for ACE2 Gene

    Alternative splice isoforms for ACE2 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for ACE2 Gene

Protein Expression for ACE2 Gene

See protein expression from ProteomicsDB, MOPED, PaxDb, and MaxQB

Selected DME Specific Peptides for ACE2 Gene

Q9BYF1:
  • PWTLALE
  • PHDETYCDPA
  • FLTAHHEMGHIQYDMAYA
  • ETEINFLLKQALTIVGTLPFTYMLEKWRWMVF
  • DQSIKVRISLKSALG
  • YFEPLFTWLK
  • LLRNGANEGFHEAVGEIMSLSAATP
  • VCHPTAWDLGKGDFRI
  • GCLPAHLLGDMWGRFWTNLY
  • WLLLSLVAV
  • MSTIYSTGK
  • DNSLEFLGI
  • DYGDYWRGDYE
  • QKPNIDVTDAM
  • YPSYISP
  • KWWEMKR
  • NPQECLLLEPGL
  • SFNFFVT
  • ASWNYNTNIT

Post-translational modifications for ACE2 Gene

  • N-glycosylation on Asn-90 may limit SARS infectivity.
  • Proteolytic cleavage by ADAM17 generates a secreted form. Also cleaved by serine proteases: TMPRSS2, TMPRSS11D and HPN/TMPRSS1.
  • Glycosylation at Asn53, Asn90, posLast=103103, Asn322, posLast=432432, posLast=546546, and posLast=690690
  • Modification sites at PhosphoSitePlus

Other Protein References for ACE2 Gene

ENSEMBL proteins:
REFSEQ proteins:

Domains & Families for ACE2 Gene

Gene Families for ACE2 Gene

IUPHAR :

Protein Domains for ACE2 Gene

InterPro:
Blocks:
ProtoNet:

Suggested Antigen Peptide Sequences for ACE2 Gene

GenScript: Design optimal peptide antigens:

Graphical View of Domain Structure for InterPro Entry

Q9BYF1

UniProtKB/Swiss-Prot:

ACE2_HUMAN :
  • Belongs to the peptidase M2 family.
Family:
  • Belongs to the peptidase M2 family.
genes like me logo Genes that share domains with ACE2: view

Function for ACE2 Gene

Products:

  1. Animal Model
  2. CRISPR
  3. miRNA
  4. Inhibitory RNA
  5. Clone
  6. Cell Line
  7. Flow Cytometry

Molecular function for ACE2 Gene

UniProtKB/Swiss-Prot BiophysicochemicalProperties:
Kinetic parameters: KM=6.9 uM for angiotensin I {ECO:0000269 PubMed:11815627}; KM=2 uM for angiotensin II {ECO:0000269 PubMed:11815627}; KM=6.8 uM for apelin-13 {ECO:0000269 PubMed:11815627}; KM=5.5 uM for dynorphin-13 {ECO:0000269 PubMed:11815627}; pH dependence: Optimum pH is 6.5 in the presence of 1 M NaCl. Active from pH 6 to 9. {ECO:0000269 PubMed:11815627};
UniProtKB/Swiss-Prot CatalyticActivity:
Angiotensin II + H(2)O = angiotensin-(1-7) + L-phenylalanine.
UniProtKB/Swiss-Prot EnzymeRegulation:
Activated by chloride and fluoride, but not bromide. Inhibited by MLN-4760, cFP_Leu, and EDTA, but not by the ACE inhibitors linosipril, captopril and enalaprilat.
UniProtKB/Swiss-Prot Function:
Carboxypeptidase which converts angiotensin I to angiotensin 1-9, a peptide of unknown function, and angiotensin II to angiotensin 1-7, a vasodilator. Also able to hydrolyze apelin-13 and dynorphin-13 with high efficiency. May be an important regulator of heart function.
UniProtKB/Swiss-Prot Function:
(Microbial infection) Acts as a receptor for SARS coronavirus/SARS-CoV and human coronavirus NL63/HCoV-NL63.
UniProtKB/Swiss-Prot Induction:
Up-regulated in failing heart.

Enzyme Numbers (IUBMB) for ACE2 Gene

Gene Ontology (GO) - Molecular Function for ACE2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0001618 virus receptor activity IMP 24227843
GO:0001948 glycoprotein binding IPI 18343844
GO:0004175 endopeptidase activity IDA 15283675
GO:0004180 carboxypeptidase activity IEA,IDA 10924499
GO:0004181 metallocarboxypeptidase activity EXP 10924499
genes like me logo Genes that share ontologies with ACE2: view
genes like me logo Genes that share phenotypes with ACE2: view

Animal Models for ACE2 Gene

MGI Knock Outs for ACE2:

Animal Model Products

  • Taconic Biosciences Mouse Models for ACE2

CRISPR Products

miRNA for ACE2 Gene

miRTarBase miRNAs that target ACE2

Inhibitory RNA Products

Clone Products

  • Addgene plasmids for ACE2

Flow Cytometry Products

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for ACE2 Gene

Localization for ACE2 Gene

Subcellular locations from UniProtKB/Swiss-Prot for ACE2 Gene

Processed angiotensin-converting enzyme 2: Secreted.
Cell membrane; Single-pass type I membrane protein. Cytoplasm. Note=Detected in both cell membrane and cytoplasm in neurons. {ECO:0000250}.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for ACE2 gene
Compartment Confidence
plasma membrane 5
extracellular 5
peroxisome 2
endoplasmic reticulum 2
cytoskeleton 1
mitochondrion 1
nucleus 1
cytosol 1
lysosome 1
endosome 1

Gene Ontology (GO) - Cellular Components for ACE2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005576 extracellular region IEA,IDA 10969042
GO:0005615 extracellular space IDA 18258853
GO:0005737 cytoplasm IEA --
GO:0005886 plasma membrane TAS --
GO:0009986 cell surface IDA 18343844
genes like me logo Genes that share ontologies with ACE2: view

Pathways & Interactions for ACE2 Gene

genes like me logo Genes that share pathways with ACE2: view

Gene Ontology (GO) - Biological Process for ACE2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0001817 regulation of cytokine production IC 15380922
GO:0002003 angiotensin maturation TAS --
GO:0002005 angiotensin catabolic process in blood IC 10924499
GO:0003051 angiotensin-mediated drinking behavior IMP 18258853
GO:0003081 regulation of systemic arterial blood pressure by renin-angiotensin IMP 18258853
genes like me logo Genes that share ontologies with ACE2: view

No data available for SIGNOR curated interactions for ACE2 Gene

Drugs & Compounds for ACE2 Gene

Products:

  1. Drug

(30) Drugs for ACE2 Gene - From: DrugBank, PharmGKB, ClinicalTrials, ApexBio, DGIdb, IUPHAR, HMDB, Tocris, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Lisinopril Approved, Investigational Pharma inhibitor, Target ACE inhibitor 117
Captopril Approved Pharma Inhibition, Inhibitor ACE inhibitor, ACE inhibitor; also inhibits LTA4 hydrolase 34
Ramipril Approved Pharma Non-peptide, competitive angiotensin-converting enzyme (ACE) inhibitor 152
Moexipril Approved Pharma Target, inhibitor 7
Water Approved Pharma 0

(7) Additional Compounds for ACE2 Gene - From: Novoseek, Tocris, and HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
Chloride ion
  • Bertholite
  • Chloor
  • Chlor
  • Chlore
  • Chloride
 16887-00-6
Benazepril hydrochloride
86541-74-4
Moexipril hydrochloride
82586-52-5

(5) Tocris Compounds for ACE2 Gene

Compound Action Cas Number
Benazepril hydrochloride Angiotensin-converting enzyme (ACE) inhibitor 86541-74-4
Moexipril hydrochloride Angiotensin-converting enzyme (ACE) inhibitor 82586-52-5
Perindopril erbumine Angiotensin-converting enzyme (ACE) inhibitor 107133-36-8
Ramipril Non-peptide, competitive angiotensin-converting enzyme (ACE) inhibitor 87333-19-5
Spinorphin Enkephalin-degrading and ACE inhibitor 137201-62-8

(6) ApexBio Compounds for ACE2 Gene

Compound Action Cas Number
Acetyl Angiotensinogen (1-14), porcine Angiotensinogen precursor 66641-26-7
Angiotensin 1/2 (1-5) Vasoconstrictor 58442-64-1
Angiotensin 1/2 + A (2 - 8) 51833-76-2
Angiotensin I (human, mouse, rat) Precursor of angiotensin II 484-42-4
Enalaprilat Dihydrate 84680-54-6
Ramipril 87333-19-5
genes like me logo Genes that share compounds with ACE2: view

Drug Products

Transcripts for ACE2 Gene

Products:

  1. CRISPR
  2. miRNA
  3. Inhibitory RNA
  4. Clone
  5. Flow Cytometry

mRNA/cDNA for ACE2 Gene

(4) REFSEQ mRNAs :
(15) Additional mRNA sequences :
(47) Selected AceView cDNA sequences:
(5) Ensembl transcripts including schematic representations, and UCSC links where relevant :

Unigene Clusters for ACE2 Gene

Angiotensin I converting enzyme (peptidyl-dipeptidase A) 2:
Representative Sequences:

CRISPR Products

Inhibitory RNA Products

Clone Products

  • Addgene plasmids for ACE2

Flow Cytometry Products

Alternative Splicing Database (ASD) splice patterns (SP) for ACE2 Gene

ExUns: 1a · 1b ^ 2a · 2b · 2c ^ 3 ^ 4a · 4b · 4c ^ 5a · 5b ^ 6 ^ 7 ^ 8 ^ 9 ^ 10a · 10b ^ 11 ^ 12 ^ 13a · 13b ^ 14 ^ 15a · 15b ^ 16 ^ 17a ·
SP1:
SP2: -
SP3: - -
SP4: - -
SP5:
SP6: -

ExUns: 17b ^ 18 ^ 19 ^ 20
SP1:
SP2:
SP3:
SP4:
SP5:
SP6:

Relevant External Links for ACE2 Gene

GeneLoc Exon Structure for
ACE2
ECgene alternative splicing isoforms for
ACE2

Expression for ACE2 Gene

Products:

  1. Primer

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for ACE2 Gene

mRNA expression in normal human tissues for ACE2 Gene
mRNA expression by BioGPS for ACE2 GenemRNA expression by GTEx for ACE2 Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

mRNA differential expression in normal tissues according to GTEx for ACE2 Gene

This gene is overexpressed in Small Intestine - Terminal Ileum (x13.3), Testis (x7.7), and Heart - Left Ventricle (x6.6).

Protein differential expression in normal tissues from HIPED for ACE2 Gene

This gene is overexpressed in Ovary (30.4), Urine (19.6), and Pancreatic juice (14.2).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, and MOPED for ACE2 Gene



NURSA nuclear receptor signaling pathways regulating expression of ACE2 Gene:

ACE2

SOURCE GeneReport for Unigene cluster for ACE2 Gene:

Hs.178098

mRNA Expression by UniProt/SwissProt for ACE2 Gene:

Q9BYF1-ACE2_HUMAN
Tissue specificity: Expressed in endothelial cells from small and large arteries, and in arterial smooth muscle cells. Expressed in lung alveolar epithelial cells, enterocytes of the small intestine, Leydig cells and Sertoli cells (at protein level). Expressed in heart, kidney, testis, and gastrointestinal system.

Evidence on tissue expression from TISSUES for ACE2 Gene

  • Heart(4.6)
  • Lung(4.5)
  • Nervous system(4.4)
  • Liver(4.3)
  • Kidney(3.6)
  • Muscle(2.8)
  • Blood(2.5)
  • Gall bladder(2.2)
genes like me logo Genes that share expression patterns with ACE2: view

Primer Products

No data available for Protein tissue co-expression partners and Phenotype-based relationships between genes and organs from Gene ORGANizer for ACE2 Gene

Orthologs for ACE2 Gene

This gene was present in the common ancestor of animals.

Orthologs for ACE2 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
 Mammalia ACE2 35 34
  • 98.53 (n)
 OneToOne
dog
(Canis familiaris)
 Mammalia ACE2 35 34
  • 86.95 (n)
 OneToOne
cow
(Bos Taurus)
 Mammalia ACE2 35 34
  • 85.24 (n)
 OneToOne
mouse
(Mus musculus)
 Mammalia Ace2 16 35 34
  • 85.1 (n)
rat
(Rattus norvegicus)
 Mammalia Ace2 34
  • 84.93 (n)
oppossum
(Monodelphis domestica)
 Mammalia ACE2 35
  • 71 (a)
 OneToOne
platypus
(Ornithorhynchus anatinus)
 Mammalia ACE2 35
  • 69 (a)
 OneToOne
chicken
(Gallus gallus)
 Aves ACE2 35 34
  • 68.7 (n)
 OneToOne
lizard
(Anolis carolinensis)
 Reptilia ACE2 35
  • 63 (a)
 OneToOne
tropical clawed frog
(Silurana tropicalis)
 Amphibia ace2 34
  • 64.56 (n)
zebrafish
(Danio rerio)
 Actinopterygii ace2 35 34
  • 61.1 (n)
 OneToOne
rainbow trout
(Oncorhynchus mykiss)
 Actinopterygii Omy.2478 34
fruit fly
(Drosophila melanogaster)
 Insecta Acer 36 35
  • 35 (a)
Ance 35
  • 35 (a)
 ManyToMany
Ance-2 36
  • 23 (a)
worm
(Caenorhabditis elegans)
 Secernentea acn-1 34 35
  • 42.11 (n)
sea squirt
(Ciona savignyi)
 Ascidiacea -- 35
  • 21 (a)
 ManyToMany
Species where no ortholog for ACE2 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for ACE2 Gene

ENSEMBL:
Gene Tree for ACE2 (if available)
TreeFam:
Gene Tree for ACE2 (if available)

Paralogs for ACE2 Gene

Paralogs for ACE2 Gene

(2) SIMAP similar genes for ACE2 Gene using alignment to 1 proteins:

genes like me logo Genes that share paralogs with ACE2: view

Variants for ACE2 Gene

Sequence variations from dbSNP and Humsavar for ACE2 Gene

SNP ID Clin Chr 0X pos Sequence Context AA Info Type
rs1000009210 -- 15,527,253(+) ATATA(G/T)ATATA intron-variant
rs1000064566 -- 15,501,225(+) CACCA(A/G)TTCTA intron-variant
rs1000074234 -- 15,572,914(+) TACAA(C/T)GGTTG intron-variant
rs1000204510 -- 15,597,673(+) GAAGA(A/G)GTGAG intron-variant
rs1000216366 -- 15,544,003(+) TAGTC(C/G)CTGCT intron-variant

Structural Variations from Database of Genomic Variants (DGV) for ACE2 Gene

Variant ID Type Subtype PubMed ID
nsv1125275 CNV insertion 24896259

Variation tolerance for ACE2 Gene

Residual Variation Intolerance Score: 49.9% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 1.61; 31.01% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for ACE2 Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
ACE2

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for ACE2 Gene

Disorders for ACE2 Gene

MalaCards: The human disease database

(6) MalaCards diseases for ACE2 Gene - From: DISEASES, Novoseek, and GeneCards

Disorder Aliases PubMed IDs
neurogenic hypertension
severe acute respiratory syndrome
  • sars
posterior urethral valves
  • posterior urethral valve
hypertension, essential
  • hypertension, essential 3
myocardial infarction
  • myocardial infarction, protection against
- elite association - COSMIC cancer census association via MalaCards
Search ACE2 in MalaCards View complete list of genes associated with diseases

Relevant External Links for ACE2

Genetic Association Database (GAD)
ACE2
Human Genome Epidemiology (HuGE) Navigator
ACE2
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
ACE2
genes like me logo Genes that share disorders with ACE2: view

No data available for UniProtKB/Swiss-Prot and Genatlas for ACE2 Gene

Publications for ACE2 Gene

  1. A novel angiotensin-converting enzyme-related carboxypeptidase (ACE2) converts angiotensin I to angiotensin 1-9. (PMID: 10969042) Donoghue M. … Acton S. (Circ. Res. 2000) 2 3 4 22 64
  2. [Relationship of angiotensin-converting enzyme 2 gene polymorphisms and vulnerability to coronary heart disease in patients with type 2 diabetes mellitus]. (PMID: 18753062) Yan Q.N. … Jiang C.X. (Nan Fang Yi Ke Da Xue Xue Bao 2008) 3 22 46 64
  3. Polymorphisms of ACE2 gene are associated with essential hypertension and antihypertensive effects of Captopril in women. (PMID: 17473847) Fan X. … Hui R. (Clin. Pharmacol. Ther. 2007) 3 22 46 64
  4. Association of angiotensin-converting enzyme 2 (ACE2) gene polymorphisms with parameters of left ventricular hypertrophy in men. Results of the MONICA Augsburg echocardiographic substudy. (PMID: 16283142) Lieb W. … Erdmann J. (J. Mol. Med. 2006) 3 22 46 64
  5. Association analysis of common variants of ELN, NOS2A, APOE and ACE2 to intracranial aneurysm. (PMID: 16574921) Mineharu Y. … Koizumi A. (Stroke 2006) 3 22 46 64

Products for ACE2 Gene

  • Addgene plasmids for ACE2

Sources for ACE2 Gene

Content
Loading form....