Free for academic non-profit institutions. Other users need a Commercial license

Aliases for ABL2 Gene

Aliases for ABL2 Gene

  • ABL Proto-Oncogene 2, Non-Receptor Tyrosine Kinase 2 3 5
  • V-Abl Abelson Murine Leukemia Viral Oncogene Homolog 2 2 3
  • C-Abl Oncogene 2, Non-Receptor Tyrosine Kinase 2 3
  • Abelson-Related Gene Protein 3 4
  • Tyrosine-Protein Kinase ARG 3 4
  • EC 2.7.10.2 4 61
  • ABLL 3 4
  • ARG 3 4
  • V-Abl Abelson Murine Leukemia Viral Oncogene Homolog 2 (Arg, Abelson-Related Gene) 2
  • Abelson Murine Leukemia Viral Oncogene Homolog 2 4
  • Abelson Tyrosine-Protein Kinase 2 3
  • Abelson-Related Gene 2
  • EC 2.7.10 61

External Ids for ABL2 Gene

Previous HGNC Symbols for ABL2 Gene

  • ABLL

Previous GeneCards Identifiers for ABL2 Gene

  • GC01M176601
  • GC01M174505
  • GC01M175616
  • GC01M176316
  • GC01M175804
  • GC01M177339
  • GC01M179068
  • GC01M150296

Summaries for ABL2 Gene

Entrez Gene Summary for ABL2 Gene

  • This gene encodes a member of the Abelson family of nonreceptor tyrosine protein kinases. The protein is highly similar to the c-abl oncogene 1 protein, including the tyrosine kinase, SH2 and SH3 domains, and it plays a role in cytoskeletal rearrangements through its C-terminal F-actin- and microtubule-binding sequences. This gene is expressed in both normal and tumor cells, and is involved in translocation with the ets variant 6 gene in leukemia. Multiple alternatively spliced transcript variants encoding different protein isoforms have been found for this gene. [provided by RefSeq, Nov 2009]

GeneCards Summary for ABL2 Gene

ABL2 (ABL Proto-Oncogene 2, Non-Receptor Tyrosine Kinase) is a Protein Coding gene. Diseases associated with ABL2 include Leukemia. Among its related pathways are Signaling by Robo receptor and ErbB signaling pathway. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is ABL1.

UniProtKB/Swiss-Prot for ABL2 Gene

  • Non-receptor tyrosine-protein kinase that plays an ABL1-overlapping role in key processes linked to cell growth and survival such as cytoskeleton remodeling in response to extracellular stimuli, cell motility and adhesion and receptor endocytosis. Coordinates actin remodeling through tyrosine phosphorylation of proteins controlling cytoskeleton dynamics like MYH10 (involved in movement); CTTN (involved in signaling); or TUBA1 and TUBB (microtubule subunits). Binds directly F-actin and regulates actin cytoskeletal structure through its F-actin-bundling activity. Involved in the regulation of cell adhesion and motility through phosphorylation of key regulators of these processes such as CRK, CRKL, DOK1 or ARHGAP35. Adhesion-dependent phosphorylation of ARHGAP35 promotes its association with RASA1, resulting in recruitment of ARHGAP35 to the cell periphery where it inhibits RHO. Phosphorylates multiple receptor tyrosine kinases like PDGFRB and other substrates which are involved in endocytosis regulation such as RIN1. In brain, may regulate neurotransmission by phosphorylating proteins at the synapse. ABL2 acts also as a regulator of multiple pathological signaling cascades during infection. Pathogens can highjack ABL2 kinase signaling to reorganize the host actin cytoskeleton for multiple purposes, like facilitating intracellular movement and host cell exit. Finally, functions as its own regulator through autocatalytic activity as well as through phosphorylation of its inhibitor, ABI1.

Gene Wiki entry for ABL2 Gene

No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for ABL2 Gene

Genomics for ABL2 Gene

Regulatory Elements for ABL2 Gene

Enhancers for ABL2 Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH01G179139 1.5 FANTOM5 ENCODE dbSUPER 27.8 +87.1 87093 5.6 TBP SIN3A RAD21 RFX5 EGR1 FOS DEK EGR2 NFYA USF2 TOR3A ABL2 AXDND1 SOAT1 ENSG00000234041 SETP10
GH01G179190 1.4 FANTOM5 Ensembl ENCODE dbSUPER 20.4 +38.8 38753 0.7 EED CREM SPI1 GABPA ABL2 AXDND1 SOAT1 TOR3A GC01P179198 SETP10
GH01G179309 1.3 FANTOM5 Ensembl ENCODE 16.7 -81.4 -81365 2.2 CBX3 FOSL1 ZNF664 ZNF121 ZNF316 CTBP1 CBX5 FOS NFE2 TRIM24 AXDND1 ABL2 TOR3A TDRD5 SOAT1 LOC100420262 GC01P179325 GC01P179326
GH01G179326 1.3 FANTOM5 Ensembl ENCODE 10.6 -98.2 -98231 3.0 PKNOX1 MAX CHD7 ZNF664 GATA3 CTBP1 RELB FOS ZBTB20 ZNF362 AXDND1 TOR3A ABL2 TDRD5 SOAT1 FAM163A GC01M179325 GC01P179326 GC01P179325
GH01G179217 1.5 FANTOM5 Ensembl ENCODE 8.7 +11.3 11334 1.6 HDGF PKNOX1 FOXA2 TCF12 ZNF766 GATA2 FOS CAVIN1 SMARCB1 ZNF592 TOR3A ABL2 SOAT1 AXDND1 LOC100499223 EIF4A1P11
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around ABL2 on UCSC Golden Path with GeneCards custom track

Promoters for ABL2 Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00000016452 193 1801 HDGF FOXA2 ARID4B SIN3A ZNF48 ZBTB7B YY1 GLIS2 FOS KDM4B

Genomic Location for ABL2 Gene

Chromosome:
1
Start:
179,099,327 bp from pter
End:
179,229,693 bp from pter
Size:
130,367 bases
Orientation:
Minus strand

Genomic View for ABL2 Gene

Genes around ABL2 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
ABL2 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for ABL2 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for ABL2 Gene

Proteins for ABL2 Gene

  • Protein details for ABL2 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    P42684-ABL2_HUMAN
    Recommended name:
    Abelson tyrosine-protein kinase 2
    Protein Accession:
    P42684
    Secondary Accessions:
    • A0M8X0
    • B7UEF2
    • B7UEF3
    • B7UEF4
    • B7UEF5
    • Q5T0X6
    • Q5W0C5
    • Q6NZY6
    • Q7Z301

    Protein attributes for ABL2 Gene

    Size:
    1182 amino acids
    Molecular mass:
    128343 Da
    Cofactor:
    Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Name=Mn(2+); Xref=ChEBI:CHEBI:29035;
    Quaternary structure:
    • Interacts with PSMA7. Interacts with CTTN. Found in a complex with ABL1, ABL2, CRK and UNC119; leading to the inhibition of CRK phosphorylation by ABL kinases.
    SequenceCaution:
    • Sequence=CAD98092.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence={ECO:0000305};

    Three dimensional structures from OCA and Proteopedia for ABL2 Gene

    Alternative splice isoforms for ABL2 Gene

neXtProt entry for ABL2 Gene

Selected DME Specific Peptides for ABL2 Gene

P42684:
  • LLYMATQI
  • RDLAARN
  • KEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCT
  • PADRPSF
  • GVWKKYSLTVAVKT
  • LFVALYD
  • KSDVWAFGVLLWEIATYGM
  • KLGGGQYG
  • HQAFETMF
  • KFPIKWTAPE
  • NSLEKHSWYHGP
  • RNKFAFREA
  • ELVHHHS
  • YGNLLDYLREC
  • TTLHYPAPK
  • INGSFLVRESESSPGQ
  • KVYELMRACW

Post-translational modifications for ABL2 Gene

  • Phosphorylated at Tyr-261 by ABL1 in response to oxidative stress. Phosphorylated by PDGFRB (By similarity).
  • Polyubiquitinated. Polyubiquitination of ABL2 leads to degradation.
  • Modification sites at PhosphoSitePlus
  • Modification sites at neXtProt

Domains & Families for ABL2 Gene

Graphical View of Domain Structure for InterPro Entry

P42684

UniProtKB/Swiss-Prot:

ABL2_HUMAN :
  • Contains two distinct classes of F-actin-binding domains. Although both can bind F-actin, the 2 are required to bundle actin filaments (By similarity).
  • Belongs to the protein kinase superfamily. Tyr protein kinase family. ABL subfamily.
Domain:
  • Contains two distinct classes of F-actin-binding domains. Although both can bind F-actin, the 2 are required to bundle actin filaments (By similarity).
Family:
  • Belongs to the protein kinase superfamily. Tyr protein kinase family. ABL subfamily.
genes like me logo Genes that share domains with ABL2: view

Function for ABL2 Gene

Molecular function for ABL2 Gene

GENATLAS Biochemistry:
Abelson murine leukemia viral (v-abl) oncogene homolog 2
UniProtKB/Swiss-Prot CatalyticActivity:
ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.
UniProtKB/Swiss-Prot EnzymeRegulation:
Stabilized in the inactive form by an association between the SH3 domain and the SH2-TK linker region, interactions of the N-terminal cap, and contributions from an N-terminal myristoyl group and phospholipids. Activated by autophosphorylation as well as by SRC-family kinase-mediated phosphorylation. Activated by RIN1 binding to the SH2 and SH3 domains. Inhibited by imatinib mesylate (Gleevec) which is used for the treatment of chronic myeloid leukemia (CML). Phosphatidylinositol 4,5-bisphosphate (PIP2), a highly abundant phosphoinositide known to regulate cytoskeletal and membrane proteins, inhibits the tyrosine kinase activity (By similarity).
UniProtKB/Swiss-Prot Function:
Non-receptor tyrosine-protein kinase that plays an ABL1-overlapping role in key processes linked to cell growth and survival such as cytoskeleton remodeling in response to extracellular stimuli, cell motility and adhesion and receptor endocytosis. Coordinates actin remodeling through tyrosine phosphorylation of proteins controlling cytoskeleton dynamics like MYH10 (involved in movement); CTTN (involved in signaling); or TUBA1 and TUBB (microtubule subunits). Binds directly F-actin and regulates actin cytoskeletal structure through its F-actin-bundling activity. Involved in the regulation of cell adhesion and motility through phosphorylation of key regulators of these processes such as CRK, CRKL, DOK1 or ARHGAP35. Adhesion-dependent phosphorylation of ARHGAP35 promotes its association with RASA1, resulting in recruitment of ARHGAP35 to the cell periphery where it inhibits RHO. Phosphorylates multiple receptor tyrosine kinases like PDGFRB and other substrates which are involved in endocytosis regulation such as RIN1. In brain, may regulate neurotransmission by phosphorylating proteins at the synapse. ABL2 acts also as a regulator of multiple pathological signaling cascades during infection. Pathogens can highjack ABL2 kinase signaling to reorganize the host actin cytoskeleton for multiple purposes, like facilitating intracellular movement and host cell exit. Finally, functions as its own regulator through autocatalytic activity as well as through phosphorylation of its inhibitor, ABI1.

Enzyme Numbers (IUBMB) for ABL2 Gene

Gene Ontology (GO) - Molecular Function for ABL2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000287 magnesium ion binding IDA 15886098
GO:0001784 phosphotyrosine binding IPI 20624904
GO:0003785 actin monomer binding TAS 20841568
GO:0004672 protein kinase activity TAS 2198571
GO:0004713 protein tyrosine kinase activity TAS --
genes like me logo Genes that share ontologies with ABL2: view
genes like me logo Genes that share phenotypes with ABL2: view

Animal Models for ABL2 Gene

MGI Knock Outs for ABL2:

Animal Model Products

  • Taconic Biosciences Mouse Models for ABL2

CRISPR Products

miRNA for ABL2 Gene

miRTarBase miRNAs that target ABL2

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for ABL2 Gene

Localization for ABL2 Gene

Subcellular locations from UniProtKB/Swiss-Prot for ABL2 Gene

Cytoplasm, cytoskeleton.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for ABL2 gene
Compartment Confidence
cytoskeleton 5
cytosol 5
plasma membrane 4
nucleus 4

Gene Ontology (GO) - Cellular Components for ABL2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005737 cytoplasm IEA --
GO:0005829 cytosol TAS --
GO:0005856 cytoskeleton IEA --
GO:0015629 actin cytoskeleton TAS 20841568
GO:0031234 extrinsic component of cytoplasmic side of plasma membrane IBA --
genes like me logo Genes that share ontologies with ABL2: view

Pathways & Interactions for ABL2 Gene

genes like me logo Genes that share pathways with ABL2: view

SIGNOR curated interactions for ABL2 Gene

Activates:
Inactivates:
Is activated by:

Gene Ontology (GO) - Biological Process for ABL2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006464 cellular protein modification process TAS 2198571
GO:0006468 protein phosphorylation IEA --
GO:0007155 cell adhesion IEA --
GO:0007165 signal transduction TAS 2198571
GO:0007169 transmembrane receptor protein tyrosine kinase signaling pathway IBA --
genes like me logo Genes that share ontologies with ABL2: view

Drugs & Compounds for ABL2 Gene

(23) Drugs for ABL2 Gene - From: DrugBank, PharmGKB, ApexBio, DGIdb, FDA Approved Drugs, HMDB, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Dasatinib Approved, Investigational Pharma Inhibition, inhibitor, Target, multitarget Kinase Inhibitors, SRC/BCR-ABL tyrosine kinase inhibitors 285
Adenosine triphosphate Approved Nutra Target, inhibitor 0
Valproic Acid Approved, Investigational Pharma HDAC1 inhibitor, Histone deacetylase (HDAC)inhibitors 327
Sprycel Approved June 2006 Pharma 0
Manganese Approved Nutra 34

(3) Additional Compounds for ABL2 Gene - From: Novoseek and HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
ADP
  • Adenosindiphosphorsaeure
  • Adenosine 5'-pyrophosphate
  • Adenosine diphosphate
  • Adenosine pyrophosphate
  • Adenosine-5'-diphosphate
Full agonist, Agonist 58-64-0

(12) ApexBio Compounds for ABL2 Gene

Compound Action Cas Number
Bafetinib (INNO-406) Bcr-Abl/Lyn tyrosine kinase inhibitor 887650-05-7
Bosutinib (SKI-606) Potent Abl/Src kinases 380843-75-4
DCC-2036 (Rebastinib) Bcr-Abl inhibitor 1020172-07-9
GNF 2 Bcr-Abl inhibitor 778270-11-4
GNF 5 Bcr-Abl inhibitor 778277-15-9
GZD824 Bcr-Abl inhibitor,novel orally bioavailable 1421783-64-3
Imatinib Mesylate (STI571) Abl/c-kit/PDGFR inhibitor 220127-57-1
KW 2449 Multikinase inhibitor 1000669-72-6
Nilotinib monohydrochloride monohydrate 923288-90-8
Nilotinib(AMN-107) Bcr-Abl kinase inhibitor,selective 641571-10-0
PD173955 Dual Src/Abl kinase inhibitor, ATP-competitive, 260415-63-2
PP121 Dual inhibitor of tyrosine and phosphoinositide kinases 1092788-83-4
genes like me logo Genes that share compounds with ABL2: view

Drug Products

Transcripts for ABL2 Gene

Unigene Clusters for ABL2 Gene

V-abl Abelson murine leukemia viral oncogene homolog 2:
Representative Sequences:

CRISPR Products

Alternative Splicing Database (ASD) splice patterns (SP) for ABL2 Gene

No ASD Table

Relevant External Links for ABL2 Gene

GeneLoc Exon Structure for
ABL2
ECgene alternative splicing isoforms for
ABL2

Expression for ABL2 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for ABL2 Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

Protein differential expression in normal tissues from HIPED for ABL2 Gene

This gene is overexpressed in Bone marrow mesenchymal stem cell (33.9), Plasma (19.4), and Liver, secretome (6.6).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for ABL2 Gene



NURSA nuclear receptor signaling pathways regulating expression of ABL2 Gene:

ABL2

SOURCE GeneReport for Unigene cluster for ABL2 Gene:

Hs.159472

mRNA Expression by UniProt/SwissProt for ABL2 Gene:

P42684-ABL2_HUMAN
Tissue specificity: Widely expressed.

Evidence on tissue expression from TISSUES for ABL2 Gene

  • Nervous system(4.6)
  • Liver(4.3)
genes like me logo Genes that share expression patterns with ABL2: view

Primer Products

No data available for mRNA differential expression in normal tissues , Protein tissue co-expression partners and Phenotype-based relationships between genes and organs from Gene ORGANizer for ABL2 Gene

Orthologs for ABL2 Gene

This gene was present in the common ancestor of animals.

Orthologs for ABL2 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia ABL2 35 34
  • 99.81 (n)
OneToOne
dog
(Canis familiaris)
Mammalia ABL2 35 34
  • 94.42 (n)
OneToOne
cow
(Bos Taurus)
Mammalia ABL2 35 34
  • 93.23 (n)
OneToOne
mouse
(Mus musculus)
Mammalia Abl2 16 35 34
  • 90.62 (n)
rat
(Rattus norvegicus)
Mammalia Abl2 34
  • 89.93 (n)
oppossum
(Monodelphis domestica)
Mammalia ABL2 35
  • 88 (a)
OneToOne
platypus
(Ornithorhynchus anatinus)
Mammalia ABL2 35
  • 88 (a)
OneToOne
chicken
(Gallus gallus)
Aves ABL2 35 34
  • 81.05 (n)
OneToOne
lizard
(Anolis carolinensis)
Reptilia ABL2 35
  • 84 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia abl2 34
  • 69.9 (n)
zebrafish
(Danio rerio)
Actinopterygii abl2 35 34
  • 67.98 (n)
OneToOne
fruit fly
(Drosophila melanogaster)
Insecta Abl 36 35
  • 72 (a)
worm
(Caenorhabditis elegans)
Secernentea abl-1 36 35
  • 59 (a)
T21G5.1 36
  • 35 (a)
kin-9 36
  • 34 (a)
W04G5.10 36
  • 33 (a)
F22B3.8 36
  • 32 (a)
F57B9.8 36
  • 32 (a)
spe-8 36
  • 32 (a)
Y38H6C.20 36
  • 32 (a)
C25A8.5 36
  • 31 (a)
F23C8.7 36
  • 31 (a)
kin-26 36
  • 31 (a)
T25B9.4 36
  • 31 (a)
T25B9.5 36
  • 31 (a)
W01B6.5 36
  • 30 (a)
Y69E1A.3 36
  • 30 (a)
K09B11.5 36
  • 29 (a)
R11E3.1 36
  • 29 (a)
ZK593.9 36
  • 29 (a)
Y52D5A.2 36
  • 28 (a)
sea squirt
(Ciona savignyi)
Ascidiacea -- 35
  • 61 (a)
OneToMany
Species where no ortholog for ABL2 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for ABL2 Gene

ENSEMBL:
Gene Tree for ABL2 (if available)
TreeFam:
Gene Tree for ABL2 (if available)

Paralogs for ABL2 Gene

Paralogs for ABL2 Gene

(17) SIMAP similar genes for ABL2 Gene using alignment to 1 proteins:

genes like me logo Genes that share paralogs with ABL2: view

Variants for ABL2 Gene

Sequence variations from dbSNP and Humsavar for ABL2 Gene

SNP ID Clin Chr 01 pos Sequence Context AA Info Type
rs386352273 Uncertain significance 179,109,182(-) TCTCT(A/G)CAGCA intron-variant, reference, synonymous-codon
rs1000031860 -- 179,207,589(+) AGCTG(A/G)GAATT intron-variant, utr-variant-5-prime
rs1000032422 -- 179,182,236(+) ACAAG(C/T)TGGGT intron-variant
rs1000039426 -- 179,190,106(+) GCCAC(A/C)GGGCC intron-variant
rs1000047585 -- 179,165,947(+) CATGC(A/T)ACCAC intron-variant

Structural Variations from Database of Genomic Variants (DGV) for ABL2 Gene

Variant ID Type Subtype PubMed ID
dgv469n100 CNV gain 25217958
dgv470n100 CNV gain 25217958
esv3575327 CNV gain 25503493
esv3578288 CNV loss 25503493
esv3588047 CNV loss 21293372
nsv1001191 CNV loss 25217958
nsv1002511 CNV gain 25217958
nsv1005278 CNV gain 25217958
nsv1009493 CNV gain 25217958
nsv1122423 CNV deletion 24896259
nsv1137825 CNV deletion 24896259
nsv946521 CNV duplication 23825009
nsv946522 CNV duplication 23825009

Variation tolerance for ABL2 Gene

Residual Variation Intolerance Score: 3.2% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 2.93; 49.08% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for ABL2 Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
ABL2

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for ABL2 Gene

Disorders for ABL2 Gene

MalaCards: The human disease database

(1) MalaCards diseases for ABL2 Gene - From: DISEASES, Novoseek, and GeneCards

Disorder Aliases PubMed IDs
leukemia
- elite association - COSMIC cancer census association via MalaCards
Search ABL2 in MalaCards View complete list of genes associated with diseases

Relevant External Links for ABL2

Genetic Association Database (GAD)
ABL2
Human Genome Epidemiology (HuGE) Navigator
ABL2
Tumor Gene Database (TGDB):
ABL2
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
ABL2
genes like me logo Genes that share disorders with ABL2: view

No data available for UniProtKB/Swiss-Prot and Genatlas for ABL2 Gene

Publications for ABL2 Gene

  1. Eight full-length abelson related gene (Arg) isoforms are constitutively expressed in caki-1 cell line and cell distribution of two isoforms has been analyzed after transfection. (PMID: 18810762) Bianchi C. … Perego R.A. (J. Cell. Biochem. 2008) 3 4 22 64
  2. Interaction between c-Abl and Arg tyrosine kinases and proteasome subunit PSMA7 regulates proteasome degradation. (PMID: 16678104) Liu X. … Cao C. (Mol. Cell 2006) 3 4 22 64
  3. Ubiquitination and degradation of the Arg tyrosine kinase is regulated by oxidative stress. (PMID: 15735735) Cao C. … Kufe D. (Oncogene 2005) 3 4 22 64
  4. A novel human gene closely related to the abl proto-oncogene. (PMID: 3787260) Kruh G.D. … Aaronson S.A. (Science 1986) 2 3 4 64
  5. A genome-wide meta-analysis of genetic variants associated with allergic rhinitis and grass sensitization and their interaction with birth order. (PMID: 22036096) Ramasamy A. … Jarvis D.L. (J. Allergy Clin. Immunol. 2011) 3 46 64

Products for ABL2 Gene

  • Addgene plasmids for ABL2

Sources for ABL2 Gene

Content
Loading form....