Free for academic non-profit institutions. Other users need a Commercial license

ABL1 Gene(Protein Coding)

ABL Proto-Oncogene 1, Non-Receptor Tyrosine Kinase

GCID:
GC09P130713
GIFtS:
74
Genes Participants
UDN Logo

Aliases for ABL1 Gene

Aliases for ABL1 Gene

  • ABL Proto-Oncogene 1, Non-Receptor Tyrosine Kinase 2 3 5
  • V-Abl Abelson Murine Leukemia Viral Oncogene Homolog 1 2 3
  • C-Abl Oncogene 1, Receptor Tyrosine Kinase 2 3
  • Abelson Tyrosine-Protein Kinase 1 3 4
  • Proto-Oncogene C-Abl 3 4
  • EC 2.7.10.2 4 61
  • JTK7 3 4
  • P150 3 4
  • ABL 3 4
  • Abelson Murine Leukemia Viral Oncogene Homolog 1 4
  • C-Abl Oncogene 1, Non-Receptor Tyrosine Kinase 2
  • Proto-Oncogene Tyrosine-Protein Kinase ABL1 3
  • Tyrosine-Protein Kinase ABL1 3
  • Bcr/C-Abl Oncogene Protein 3
  • EC 2.7.10 61
  • Bcr/Abl 3
  • C-ABL1 3
  • C-ABL 3
  • V-Abl 3

External Ids for ABL1 Gene

Previous HGNC Symbols for ABL1 Gene

  • ABL

Previous GeneCards Identifiers for ABL1 Gene

  • GC09P124604
  • GC09P125136
  • GC09P126943
  • GC09P128865
  • GC09P130619
  • GC09P132579
  • GC09P133589
  • GC09P103075

Summaries for ABL1 Gene

Entrez Gene Summary for ABL1 Gene

  • This gene is a protooncogene that encodes a protein tyrosine kinase involved in a variety of cellular processes, including cell division, adhesion, differentiation, and response to stress. The activity of the protein is negatively regulated by its SH3 domain, whereby deletion of the region encoding this domain results in an oncogene. The ubiquitously expressed protein has DNA-binding activity that is regulated by CDC2-mediated phosphorylation, suggesting a cell cycle function. This gene has been found fused to a variety of translocation partner genes in various leukemias, most notably the t(9;22) translocation that results in a fusion with the 5' end of the breakpoint cluster region gene (BCR; MIM:151410). Alternative splicing of this gene results in two transcript variants, which contain alternative first exons that are spliced to the remaining common exons. [provided by RefSeq, Aug 2014]

CIViC summary for ABL1 Gene

  • ABL1 is most relevant to cancer in its role in the BCR-ABL fusion protein that has become a signature of chronic myeloid leukemia (CML). Cells harboring this fusion have shown sensitivity to imatinib, greatly improving the prognostic outlook of the disease. However, additional mutations in ABL1 have been shown to confer resistance to imatinib. In these resistance cases, second-generation tyrosine kinase inhibitors such as dasatinib and nilotinib have exhibited some efficacy and are currently undergoing clinical trials for treating acquired resistance in CML.

GeneCards Summary for ABL1 Gene

ABL1 (ABL Proto-Oncogene 1, Non-Receptor Tyrosine Kinase) is a Protein Coding gene. Diseases associated with ABL1 include Leukemia, Chronic Myeloid, Somatic and Leukemia, Acute Lymphoblastic 3. Among its related pathways are DNA Double-Strand Break Repair and Signaling by Robo receptor. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is ABL2.

UniProtKB/Swiss-Prot for ABL1 Gene

  • Non-receptor tyrosine-protein kinase that plays a role in many key processes linked to cell growth and survival such as cytoskeleton remodeling in response to extracellular stimuli, cell motility and adhesion, receptor endocytosis, autophagy, DNA damage response and apoptosis. Coordinates actin remodeling through tyrosine phosphorylation of proteins controlling cytoskeleton dynamics like WASF3 (involved in branch formation); ANXA1 (involved in membrane anchoring); DBN1, DBNL, CTTN, RAPH1 and ENAH (involved in signaling); or MAPT and PXN (microtubule-binding proteins). Phosphorylation of WASF3 is critical for the stimulation of lamellipodia formation and cell migration. Involved in the regulation of cell adhesion and motility through phosphorylation of key regulators of these processes such as BCAR1, CRK, CRKL, DOK1, EFS or NEDD9. Phosphorylates multiple receptor tyrosine kinases and more particularly promotes endocytosis of EGFR, facilitates the formation of neuromuscular synapses through MUSK, inhibits PDGFRB-mediated chemotaxis and modulates the endocytosis of activated B-cell receptor complexes. Other substrates which are involved in endocytosis regulation are the caveolin (CAV1) and RIN1. Moreover, ABL1 regulates the CBL family of ubiquitin ligases that drive receptor down-regulation and actin remodeling. Phosphorylation of CBL leads to increased EGFR stability. Involved in late-stage autophagy by regulating positively the trafficking and function of lysosomal components. ABL1 targets to mitochondria in response to oxidative stress and thereby mediates mitochondrial dysfunction and cell death. ABL1 is also translocated in the nucleus where it has DNA-binding activity and is involved in DNA-damage response and apoptosis. Many substrates are known mediators of DNA repair: DDB1, DDB2, ERCC3, ERCC6, RAD9A, RAD51, RAD52 or WRN. Activates the proapoptotic pathway when the DNA damage is too severe to be repaired. Phosphorylates TP73, a primary regulator for this type of damage-induced apoptosis. Phosphorylates the caspase CASP9 on Tyr-153 and regulates its processing in the apoptotic response to DNA damage. Phosphorylates PSMA7 that leads to an inhibition of proteasomal activity and cell cycle transition blocks. ABL1 acts also as a regulator of multiple pathological signaling cascades during infection. Several known tyrosine-phosphorylated microbial proteins have been identified as ABL1 substrates. This is the case of A36R of Vaccinia virus, Tir (translocated intimin receptor) of pathogenic E.coli and possibly Citrobacter, CagA (cytotoxin-associated gene A) of H.pylori, or AnkA (ankyrin repeat-containing protein A) of A.phagocytophilum. Pathogens can highjack ABL1 kinase signaling to reorganize the host actin cytoskeleton for multiple purposes, like facilitating intracellular movement and host cell exit. Finally, functions as its own regulator through autocatalytic activity as well as through phosphorylation of its inhibitor, ABI1.

Tocris Summary for ABL1 Gene

  • The Abl family of non-receptor tyrosine kinases includes c-Abl (Abelson tyrosine kinase) and Arg (Abl2) subtypes. c-Abl is localized at many subcellular sites including the nucleus, cytoplasm, mitochondria and endoplasmic reticulum, where it interacts with several proteins.

Gene Wiki entry for ABL1 Gene

PharmGKB "VIP" Summary for ABL1 Gene

No data available for fRNAdb sequence ontologies and piRNA Summary for ABL1 Gene

Genomics for ABL1 Gene

Products:

  1. Regulatory Element

Regulatory Elements for ABL1 Gene

Enhancers for ABL1 Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH09G130856 1.9 FANTOM5 Ensembl ENCODE dbSUPER 17.7 +146.5 146457 7.4 FOXA2 PKNOX1 WRNIP1 ARID4B SIN3A DMAP1 YY1 ZNF143 FOS DEK ABL1 FIBCD1 QRFP LOC105376297 EXOSC2 GC09P130864 GC09P130853 GC09P130854
GH09G130842 1.9 FANTOM5 Ensembl ENCODE dbSUPER 12.1 +132.5 132506 7.8 SIN3A FEZF1 GLI4 ZNF2 YY1 GTF3C2 ZNF121 GATA2 KLF7 FOS ABL1 QRFP ENSG00000236986 SNORD62B GC09P130853 GC09P130854 GC09P130796
GH09G130833 1.3 ENCODE dbSUPER 17.3 +122.0 121958 5.1 PKNOX1 SIN3A ARID4B FEZF1 DMAP1 YBX1 ZNF2 YY1 FOS DEK ABL1 EXOSC2 PRDM12 GC09P130853 GC09P130854 GC09P130796
GH09G130778 1.6 Ensembl ENCODE dbSUPER 11.4 +67.0 66977 4.9 PKNOX1 FOXA2 ARNT ARID4B FEZF1 ZNF2 YY1 FOS DEK ZNF263 ABL1 QRFP GC09P130796 RPL37P17
GH09G130839 1.2 Ensembl dbSUPER 11.4 +125.6 125620 1.0 FOXA2 MLX ZFP64 ARID4B DMAP1 ZNF48 YY1 FOS SP5 ZHX2 ABL1 EXOSC2 PRDM12 AIF1L GC09P130853 GC09P130854 GC09P130796
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around ABL1 on UCSC Golden Path with GeneCards custom track

Promoters for ABL1 Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00000242233 220 3800 CREB3L1 SIN3A ZNF2 YY1 ZNF766 ZNF143 FOS SP3 CEBPZ MXD4

Transcription factor binding sites by QIAGEN in the ABL1 gene promoter:

Genomic Location for ABL1 Gene

Chromosome:
9
Start:
130,713,881 bp from pter
End:
130,887,675 bp from pter
Size:
173,795 bases
Orientation:
Plus strand

Genomic View for ABL1 Gene

Genes around ABL1 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
ABL1 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for ABL1 Gene
GeneLoc Logo Genomic Neighborhood • Exon Structure • Gene Density

RefSeq DNA sequence for ABL1 Gene

Proteins for ABL1 Gene

Products:

  1. Antibody
  2. Protein
  3. Assay

  • Protein details for ABL1 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    P00519-ABL1_HUMAN
    Recommended name:
    Tyrosine-protein kinase ABL1
    Protein Accession:
    P00519
    Secondary Accessions:
    • A3KFJ3
    • Q13869
    • Q13870
    • Q16133
    • Q17R61
    • Q45F09

    Protein attributes for ABL1 Gene

    Size:
    1130 amino acids
    Molecular mass:
    122873 Da
    Cofactor:
    Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Name=Mn(2+); Xref=ChEBI:CHEBI:29035;
    Quaternary structure:
    • Interacts with SORBS1 following insulin stimulation. Found in a trimolecular complex containing CDK5 and CABLES1. Interacts with CABLES1 and PSTPIP1. Interacts with ZDHHC16, ITGB1 and HCK (By similarity). Interacts with STX17; probably phosphorylates STX17. Interacts with INPPL1/SHIP2. Interacts with the 14-3-3 proteins, YWHAB, YWHAE, YWHAG, YWHAH, SFN AND YWHAZ; the interaction with 14-3-3 proteins requires phosphorylation on Thr-735 and, sequesters ABL1 into the cytoplasm. Interacts with ABI1, ABI2, BCR, CRK, FGR, FYN, HCK, LYN, PSMA7 RAD9A, RAD51, RAD52, TP73 and WASF3. A complex made of ABL1, CTTN and MYLK regulates cortical actin-based cytoskeletal rearrangement critical to sphingosine 1-phosphate (S1P)-mediated endothelial cell (EC) barrier enhancement. Interacts (via SH3 domain) with CASP9; the interaction is direct and increases in the response of cells to genotoxic stress and ABL1/c-Abl activation. Found in a complex with ABL1, ABL2, CRK and UNC119; leading to the inhibition of CRK phosphorylation by ABL kinases.

    Three dimensional structures from OCA and Proteopedia for ABL1 Gene

    Alternative splice isoforms for ABL1 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for ABL1 Gene

Protein Expression for ABL1 Gene

See protein expression from ProteomicsDB, MOPED, PaxDb, and MaxQB

Selected DME Specific Peptides for ABL1 Gene

P00519:
  • PLRRQVTV
  • LLYMATQI
  • RDLAARN
  • KLGGGQYG
  • KEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCT
  • HQAFETMF
  • LAYNKFS
  • KFPIKWTAPE
  • NSLEKHSWYHGP
  • RNKFAFREA
  • ELVHHHS
  • GVWKKYSLTVAVKT
  • YGNLLDYLREC
  • GVCTREPPFYIITEFM
  • TTLHYPAPK
  • INGSFLVRESESSPGQ
  • KVYELMRACW
  • LFVALYD
  • KSDVWAFGVLLWEIATYGM

Post-translational modifications for ABL1 Gene

  • Acetylated at Lys-711 by EP300 which promotes the cytoplasmic translocation.
  • Phosphorylation at Tyr-70 by members of the SRC family of kinases disrupts SH3 domain-based autoinhibitory interactions and intermolecular associations, such as that with ABI1, and also enhances kinase activity. Phosphorylation at Tyr-226 and Tyr-393 correlate with increased activity. DNA damage-induced activation of ABL1 requires the function of ATM and Ser-446 phosphorylation (By similarity). Phosphorylation at Ser-569 has been attributed to a CDC2-associated kinase and is coupled to cell division (By similarity). Phosphorylation at Ser-618 and Ser-619 by PAK2 increases binding to CRK and reduces binding to ABI1. Phosphorylation on Thr-735 is required for binding 14-3-3 proteins for cytoplasmic translocation. Phosphorylated by PRKDC (By similarity).
  • Polyubiquitinated. Polyubiquitination of ABL1 leads to degradation.
  • Modification sites at PhosphoSitePlus
  • Modification sites at neXtProt

Other Protein References for ABL1 Gene

ENSEMBL proteins:
REFSEQ proteins:

Domains & Families for ABL1 Gene

Gene Families for ABL1 Gene

HGNC:
IUPHAR :

Protein Domains for ABL1 Gene

InterPro:
Blocks:
ProtoNet:

Suggested Antigen Peptide Sequences for ABL1 Gene

GenScript: Design optimal peptide antigens:

Graphical View of Domain Structure for InterPro Entry

P00519

UniProtKB/Swiss-Prot:

ABL1_HUMAN :
  • Belongs to the protein kinase superfamily. Tyr protein kinase family. ABL subfamily.
Family:
  • Belongs to the protein kinase superfamily. Tyr protein kinase family. ABL subfamily.
genes like me logo Genes that share domains with ABL1: view

Function for ABL1 Gene

Products:

  1. Animal Model
  2. CRISPR
  3. miRNA
  4. Inhibitory RNA
  5. Clone
  6. Cell Line
  7. Flow Cytometry

Molecular function for ABL1 Gene

GENATLAS Biochemistry:
Abelson murine leukemia viral (v-abl) oncogene homolog 1,nucleocytoplasmic shuttling protein,with a loss from the nucleus upon adhesion to fibronectin matrix,,activated by certain DNA-damaging agents from ionizing radiation to alkylating agents,promoting cell cycle arrest by blocking the G/S transition-in a TP53 dependent way,regulated by ATM,requiring mitogen-activated protein kinase kinase 6 activation (MAP2K6) for inducing apoptosis,activating TP73 in a mismatch repair dependent apoptosis pathway and MAP2K6 (for CABL induced apoptosis)
UniProtKB/Swiss-Prot CatalyticActivity:
ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.
UniProtKB/Swiss-Prot EnzymeRegulation:
Stabilized in the inactive form by an association between the SH3 domain and the SH2-TK linker region, interactions of the N-terminal cap, and contributions from an N-terminal myristoyl group and phospholipids. Activated by autophosphorylation as well as by SRC-family kinase-mediated phosphorylation. Activated by RIN1 binding to the SH2 and SH3 domains. Also stimulated by cell death inducers and DNA-damage. Phosphatidylinositol 4,5-bisphosphate (PIP2), a highly abundant phosphoinositide known to regulate cytoskeletal and membrane proteins, inhibits also the tyrosine kinase activity (By similarity). Inhibited by ABI1, whose activity is controlled by ABL1 itself through tyrosine phosphorylation. Also inhibited by imatinib mesylate (Gleevec) which is used for the treatment of chronic myeloid leukemia (CML), and by VX-680, an inhibitor that acts also on imatinib-resistant mutants.
UniProtKB/Swiss-Prot Function:
Non-receptor tyrosine-protein kinase that plays a role in many key processes linked to cell growth and survival such as cytoskeleton remodeling in response to extracellular stimuli, cell motility and adhesion, receptor endocytosis, autophagy, DNA damage response and apoptosis. Coordinates actin remodeling through tyrosine phosphorylation of proteins controlling cytoskeleton dynamics like WASF3 (involved in branch formation); ANXA1 (involved in membrane anchoring); DBN1, DBNL, CTTN, RAPH1 and ENAH (involved in signaling); or MAPT and PXN (microtubule-binding proteins). Phosphorylation of WASF3 is critical for the stimulation of lamellipodia formation and cell migration. Involved in the regulation of cell adhesion and motility through phosphorylation of key regulators of these processes such as BCAR1, CRK, CRKL, DOK1, EFS or NEDD9. Phosphorylates multiple receptor tyrosine kinases and more particularly promotes endocytosis of EGFR, facilitates the formation of neuromuscular synapses through MUSK, inhibits PDGFRB-mediated chemotaxis and modulates the endocytosis of activated B-cell receptor complexes. Other substrates which are involved in endocytosis regulation are the caveolin (CAV1) and RIN1. Moreover, ABL1 regulates the CBL family of ubiquitin ligases that drive receptor down-regulation and actin remodeling. Phosphorylation of CBL leads to increased EGFR stability. Involved in late-stage autophagy by regulating positively the trafficking and function of lysosomal components. ABL1 targets to mitochondria in response to oxidative stress and thereby mediates mitochondrial dysfunction and cell death. ABL1 is also translocated in the nucleus where it has DNA-binding activity and is involved in DNA-damage response and apoptosis. Many substrates are known mediators of DNA repair: DDB1, DDB2, ERCC3, ERCC6, RAD9A, RAD51, RAD52 or WRN. Activates the proapoptotic pathway when the DNA damage is too severe to be repaired. Phosphorylates TP73, a primary regulator for this type of damage-induced apoptosis. Phosphorylates the caspase CASP9 on Tyr-153 and regulates its processing in the apoptotic response to DNA damage. Phosphorylates PSMA7 that leads to an inhibition of proteasomal activity and cell cycle transition blocks. ABL1 acts also as a regulator of multiple pathological signaling cascades during infection. Several known tyrosine-phosphorylated microbial proteins have been identified as ABL1 substrates. This is the case of A36R of Vaccinia virus, Tir (translocated intimin receptor) of pathogenic E.coli and possibly Citrobacter, CagA (cytotoxin-associated gene A) of H.pylori, or AnkA (ankyrin repeat-containing protein A) of A.phagocytophilum. Pathogens can highjack ABL1 kinase signaling to reorganize the host actin cytoskeleton for multiple purposes, like facilitating intracellular movement and host cell exit. Finally, functions as its own regulator through autocatalytic activity as well as through phosphorylation of its inhibitor, ABI1.

Enzyme Numbers (IUBMB) for ABL1 Gene

Gene Ontology (GO) - Molecular Function for ABL1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000287 magnesium ion binding IDA 9144171
GO:0001784 phosphotyrosine binding IPI 20624904
GO:0003677 DNA binding NAS 8242749
GO:0003785 actin monomer binding TAS 20841568
GO:0004515 nicotinate-nucleotide adenylyltransferase activity TAS 20841568
genes like me logo Genes that share ontologies with ABL1: view

Phenotypes for ABL1 Gene

MGI mutant phenotypes for ABL1:
inferred from 9 alleles
GenomeRNAi human phenotypes for ABL1:
genes like me logo Genes that share phenotypes with ABL1: view

Human Phenotype Ontology for ABL1 Gene

HPO Id HPO Name Alternative Ids Definition Synonyms

Animal Models for ABL1 Gene

MGI Knock Outs for ABL1:

Animal Model Products

Inhibitory RNA Products

Clone Products

  • Addgene plasmids for ABL1

Flow Cytometry Products

No data available for Transcription Factor Targets and HOMER Transcription for ABL1 Gene

Localization for ABL1 Gene

Subcellular locations from UniProtKB/Swiss-Prot for ABL1 Gene

Cytoplasm, cytoskeleton. Nucleus. Mitochondrion. Note=Shuttles between the nucleus and cytoplasm depending on environmental signals. Sequestered into the cytoplasm through interaction with 14-3-3 proteins. Localizes to mitochondria in response to oxidative stress (By similarity). {ECO:0000250}.
Isoform IB: Nucleus membrane; Lipid-anchor. Note=The myristoylated c-ABL protein is reported to be nuclear.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for ABL1 gene
Compartment Confidence
plasma membrane 5
cytoskeleton 5
mitochondrion 5
nucleus 5
cytosol 5
extracellular 1

Gene Ontology (GO) - Cellular Components for ABL1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005634 nucleus TAS 20841568
GO:0005654 nucleoplasm TAS --
GO:0005730 nucleolus IDA 12944467
GO:0005737 cytoplasm TAS 20841568
GO:0005739 mitochondrion NAS 24522549
genes like me logo Genes that share ontologies with ABL1: view

Pathways & Interactions for ABL1 Gene

genes like me logo Genes that share pathways with ABL1: view

SIGNOR curated interactions for ABL1 Gene

Activates:
Inactivates:
Is activated by:
Is inactivated by:
Other effect:

Gene Ontology (GO) - Biological Process for ABL1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000278 mitotic cell cycle TAS 24522549
GO:0001843 neural tube closure IEA --
GO:0001922 B-1 B cell homeostasis IEA --
GO:0001934 positive regulation of protein phosphorylation IMP 24700464
GO:0002322 B cell proliferation involved in immune response IEA --
genes like me logo Genes that share ontologies with ABL1: view

Drugs & Compounds for ABL1 Gene

Products:

  1. Drug

(84) Drugs for ABL1 Gene - From: DrugBank, PharmGKB, ApexBio, DGIdb, FDA Approved Drugs, HMDB, Tocris, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Dasatinib Approved, Investigational Pharma Inhibition, inhibitor, Target, multitarget Kinase Inhibitors, SRC/BCR-ABL tyrosine kinase inhibitors 285
Nilotinib Approved, Investigational Pharma Inhibition, inhibitor, Target Kinase Inhibitors 0
imatinib Approved Pharma inhibitor, Target Kinase Inhibitors, SRC/BCR-ABL tyrosine kinase inhibitors 0
bosutinib Approved Pharma inhibitor, Target Kinase Inhibitors, SRC/BCR-ABL tyrosine kinase inhibitors 0
ponatinib Approved Pharma inhibitor, Target Kinase Inhibitors, Fibroblast growth factor receptor (FGFR)inhibitors 32

(20) Additional Compounds for ABL1 Gene - From: Novoseek, HMDB, and Tocris

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
ADP
  • Adenosindiphosphorsaeure
  • Adenosine 5'-pyrophosphate
  • Adenosine diphosphate
  • Adenosine pyrophosphate
  • Adenosine-5'-diphosphate
 Full agonist, Agonist 58-64-0
N-desmethylimatinib
  • CGP74588
AP 24534
943319-70-8

(5) Tocris Compounds for ABL1 Gene

Compound Action Cas Number
Adaphostin p210bcr/abl kinase inhibitor 241127-58-2
AP 24534 Potent multi-kinase and pan-Bcr-Abl inhibitor 943319-70-8
GNF 2 Selective allosteric inhibitor of Bcr-Abl tyrosine kinase activity 778270-11-4
GNF 5 Selective allosteric inhibitor of Bcr-Abl; analog of GNF 2 (Cat. No. 4399) 778277-15-9
PPY A Potent inhibitor of Abl T315l mutant and wild-type Abl kinases 875634-01-8

(25) ApexBio Compounds for ABL1 Gene

Compound Action Cas Number
1-Naphthyl PP1 Src family kinases inhibitor 221243-82-9
Adaphostin P210bcr/abl tyrosine kinase inhibitor 241127-58-2
AT9283 Aurora kinase/JAK inhibitor 896466-04-9
Bafetinib (INNO-406) Bcr-Abl/Lyn tyrosine kinase inhibitor 887650-05-7
Bosutinib (SKI-606) Potent Abl/Src kinases 380843-75-4
CHMFL-ABL-053 BCR-ABL inhibitor 1808287-83-3
Dasatinib (BMS-354825) Src and BCR-Abl inhibitor 302962-49-8
DCC-2036 (Rebastinib) Bcr-Abl inhibitor 1020172-07-9
DPH c-ABL activitor 484049-04-9
GNF 2 Bcr-Abl inhibitor 778270-11-4
GNF 5 Bcr-Abl inhibitor 778277-15-9
GNF-7 839706-07-9
GZD824 Bcr-Abl inhibitor,novel orally bioavailable 1421783-64-3
Imatinib (STI571) Protein-tyrosine kinase inhibitor 152459-95-5
Imatinib Mesylate (STI571) Abl/c-kit/PDGFR inhibitor 220127-57-1
KW 2449 Multikinase inhibitor 1000669-72-6
Nilotinib(AMN-107) Bcr-Abl kinase inhibitor,selective 641571-10-0
ON 146040 1404231-34-0
PD 180970 P210bcr/abl tyrosine kinase inhibitor 287204-45-9
PD173955 Dual Src/Abl kinase inhibitor, ATP-competitive, 260415-63-2
Ponatinib (AP24534) pan-BCR-ABL inhibitor,multi-kinase inhibitor 943319-70-8
PP121 Dual inhibitor of tyrosine and phosphoinositide kinases 1092788-83-4
PPY A Bl kinases inhibitor 875634-01-8
Saracatinib (AZD0530) Src/Abl inhibitor,potent and selective 379231-04-6
XL228 IGF1R/AURORA /FGFR1-3/ABL/SRC family kinases inhibitor 898280-07-4
genes like me logo Genes that share compounds with ABL1: view

Drug Products

Transcripts for ABL1 Gene

Products:

  1. CRISPR
  2. miRNA
  3. Inhibitory RNA
  4. Clone
  5. Flow Cytometry

mRNA/cDNA for ABL1 Gene

(2) REFSEQ mRNAs :
(28) Additional mRNA sequences :
(43) Selected AceView cDNA sequences:
(3) Ensembl transcripts including schematic representations, and UCSC links where relevant :

Unigene Clusters for ABL1 Gene

C-abl oncogene 1, non-receptor tyrosine kinase:
Representative Sequences:

Inhibitory RNA Products

Clone Products

  • Addgene plasmids for ABL1

Flow Cytometry Products

Alternative Splicing Database (ASD) splice patterns (SP) for ABL1 Gene

No ASD Table

Relevant External Links for ABL1 Gene

GeneLoc Exon Structure for
ABL1
ECgene alternative splicing isoforms for
ABL1

Expression for ABL1 Gene

Products:

  1. Primer

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for ABL1 Gene

mRNA expression in normal human tissues for ABL1 Gene
mRNA expression by BioGPS for ABL1 GenemRNA expression by GTEx for ABL1 Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

Protein differential expression in normal tissues from HIPED for ABL1 Gene

This gene is overexpressed in Testis (17.7), Ovary (12.9), CD8 Tcells (7.3), and Pancreas (6.9).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for ABL1 Gene



Protein tissue co-expression partners for ABL1 Gene

NURSA nuclear receptor signaling pathways regulating expression of ABL1 Gene:

ABL1

SOURCE GeneReport for Unigene cluster for ABL1 Gene:

Hs.431048

mRNA Expression by UniProt/SwissProt for ABL1 Gene:

P00519-ABL1_HUMAN
Tissue specificity: Widely expressed.

Evidence on tissue expression from TISSUES for ABL1 Gene

  • Nervous system(4.8)
  • Lung(4.4)
  • Liver(4.3)
  • Bone marrow(3.5)
  • Blood(3.3)
  • Skin(3.1)
  • Spleen(2.5)
  • Lymph node(2.2)
  • Heart(2.1)
  • Intestine(2.1)
  • Muscle(2.1)
  • Kidney(2)

Phenotype-based relationships between genes and organs from Gene ORGANizer for ABL1 Gene

Germ Layers:
  • mesoderm
Systems:
  • immune
  • lymphatic
Organs:
General:
  • blood
  • bone marrow
  • white blood cell
genes like me logo Genes that share expression patterns with ABL1: view

Primer Products

No data available for mRNA differential expression in normal tissues for ABL1 Gene

Orthologs for ABL1 Gene

This gene was present in the common ancestor of animals.

Orthologs for ABL1 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
 Mammalia ABL1 34 35
  • 99.48 (n)
oppossum
(Monodelphis domestica)
 Mammalia ABL1 35
  • 93 (a)
 OneToOne
dog
(Canis familiaris)
 Mammalia ABL1 34 35
  • 88.36 (n)
cow
(Bos Taurus)
 Mammalia ABL1 34 35
  • 87.43 (n)
mouse
(Mus musculus)
 Mammalia Abl1 34 16 35
  • 85.46 (n)
rat
(Rattus norvegicus)
 Mammalia Abl1 34
  • 85.09 (n)
platypus
(Ornithorhynchus anatinus)
 Mammalia ABL1 35
  • 85 (a)
 OneToOne
chicken
(Gallus gallus)
 Aves ABL 35
  • 82 (a)
 OneToOne
ABL1 34
  • 78.3 (n)
lizard
(Anolis carolinensis)
 Reptilia ABL1 35
  • 78 (a)
 OneToOne
tropical clawed frog
(Silurana tropicalis)
 Amphibia abl1 34
  • 71.66 (n)
Str.19066 34
zebrafish
(Danio rerio)
 Actinopterygii abl1 34 35
  • 70.24 (n)
fruit fly
(Drosophila melanogaster)
 Insecta Abl 36 35
  • 74 (a)
worm
(Caenorhabditis elegans)
 Secernentea abl-1 36 35
  • 55 (a)
R11E3.1 36
  • 37 (a)
T21G5.1 36
  • 36 (a)
kin-9 36
  • 35 (a)
Y50D4B.6 36
  • 35 (a)
T14E8.1b 36
  • 34 (a)
C25A8.5 36
  • 32 (a)
T14E8.1a 36
  • 32 (a)
F23C8.7 36
  • 31 (a)
Y38H6C.20 36
  • 31 (a)
F57B9.8 36
  • 30 (a)
kin-26 36
  • 30 (a)
spe-8 36
  • 30 (a)
T25B9.4 36
  • 30 (a)
T25B9.5 36
  • 29 (a)
Y69E1A.3 36
  • 29 (a)
K09B11.5 36
  • 28 (a)
W02A2.4 36
  • 28 (a)
ZK593.9 36
  • 28 (a)
Y52D5A.2 36
  • 26 (a)
sea squirt
(Ciona savignyi)
 Ascidiacea -- 35
  • 62 (a)
 OneToMany
Species where no ortholog for ABL1 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for ABL1 Gene

ENSEMBL:
Gene Tree for ABL1 (if available)
TreeFam:
Gene Tree for ABL1 (if available)

Paralogs for ABL1 Gene

Paralogs for ABL1 Gene

(130) SIMAP similar genes for ABL1 Gene using alignment to 10 proteins:

genes like me logo Genes that share paralogs with ABL1: view

Variants for ABL1 Gene

Sequence variations from dbSNP and Humsavar for ABL1 Gene

SNP ID Clin Chr 09 pos Sequence Context AA Info Type
VAR_032676 A lung large cell carcinoma sample
VAR_032677 A melanoma sample
rs121913457 Pathogenic 130,873,004(+) AGCCA(C/T)GGAGT reference, missense
rs121913459 Pathogenic 130,872,896(+) CATCA(C/T)TGAGT reference, missense
rs121913461 Pathogenic 130,862,970(+) GCCAG(C/T)ACGGG reference, missense

Structural Variations from Database of Genomic Variants (DGV) for ABL1 Gene

Variant ID Type Subtype PubMed ID
dgv2184e212 CNV loss 25503493
esv1117111 CNV deletion 17803354
esv24869 CNV gain+loss 19812545
esv2669083 CNV deletion 23128226
esv2674290 CNV deletion 23128226
esv2739108 CNV deletion 23290073
esv2759717 CNV loss 17122850
esv32595 CNV loss 17666407
esv3396177 CNV duplication 20981092
esv3398293 CNV insertion 20981092
esv3545532 CNV deletion 23714750
esv3573401 CNV loss 25503493
esv3621866 CNV gain 21293372
esv3621867 CNV loss 21293372
esv3621868 CNV loss 21293372
esv3621869 CNV loss 21293372
esv3621870 CNV loss 21293372
nsv1037964 CNV loss 25217958
nsv1049425 CNV loss 25217958
nsv1049539 CNV loss 25217958
nsv1053512 CNV loss 25217958
nsv1126924 CNV deletion 24896259
nsv615533 CNV loss 21841781
nsv6735 CNV deletion 18451855
nsv820967 CNV deletion 20802225
nsv831735 CNV loss 17160897
nsv951789 CNV deletion 24416366

Variation tolerance for ABL1 Gene

Residual Variation Intolerance Score: 4.4% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 2.80; 47.50% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for ABL1 Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
ABL1

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for ABL1 Gene

Disorders for ABL1 Gene

MalaCards: The human disease database

(21) MalaCards diseases for ABL1 Gene - From: GeneTests, Orphanet, DISEASES, Novoseek, and GeneCards

Disorder Aliases PubMed IDs
leukemia, chronic myeloid, somatic
  • leukemia, chronic myeloid
leukemia, acute lymphoblastic 3
  • leukemia, acute lymphoblastic, susceptibility to, 3
abl1 kd-related altered drug metabolism
precursor t-cell acute lymphoblastic leukemia
  • t-all
leukemia
- elite association - COSMIC cancer census association via MalaCards
Search ABL1 in MalaCards View complete list of genes associated with diseases

UniProtKB/Swiss-Prot

ABL1_HUMAN
  • Leukemia, chronic myeloid (CML) [MIM:608232]: A clonal myeloproliferative disorder of a pluripotent stem cell with a specific cytogenetic abnormality, the Philadelphia chromosome (Ph), involving myeloid, erythroid, megakaryocytic, B-lymphoid, and sometimes T-lymphoid cells, but not marrow fibroblasts. Note=The gene represented in this entry is involved in disease pathogenesis.
  • Note=A chromosomal aberration involving ABL1 has been found in patients with chronic myeloid leukemia. Translocation t(9;22)(q34;q11) with BCR. The translocation produces a BCR-ABL found also in acute myeloid leukemia (AML) and acute lymphoblastic leukemia (ALL).

Relevant External Links for ABL1

Genetic Association Database (GAD)
ABL1
Human Genome Epidemiology (HuGE) Navigator
ABL1
Tumor Gene Database (TGDB):
ABL1
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
ABL1
genes like me logo Genes that share disorders with ABL1: view

No data available for Genatlas for ABL1 Gene

Publications for ABL1 Gene

  1. Cbl-associated protein is tyrosine phosphorylated by c-Abl and c-Src kinases. (PMID: 19891780) Fernow I. … Tikkanen R. (BMC Cell Biol. 2009) 3 4 22 64
  2. Allosteric inhibition of the nonMyristoylated c-Abl tyrosine kinase by phosphopeptides derived from Abi1/Hssh3bp1. (PMID: 18328268) Xiong X. … Kotula L. (Biochim. Biophys. Acta 2008) 3 4 22 64
  3. Interaction between c-Abl and Arg tyrosine kinases and proteasome subunit PSMA7 regulates proteasome degradation. (PMID: 16678104) Liu X. … Cao C. (Mol. Cell 2006) 3 4 22 64
  4. c-Abl acetylation by histone acetyltransferases regulates its nuclear-cytoplasmic localization. (PMID: 16648821) di Bari M.G. … Barila D. (EMBO Rep. 2006) 3 4 22 64
  5. JNK phosphorylation of 14-3-3 proteins regulates nuclear targeting of c-Abl in the apoptotic response to DNA damage. (PMID: 15696159) Yoshida K. … Miki Y. (Nat. Cell Biol. 2005) 3 4 22 64

Products for ABL1 Gene

  • Addgene plasmids for ABL1

Sources for ABL1 Gene

Content
Loading form....